"BCAR1" Related Products

Expand

Recombinant Human BCAR1 Protein, GST-tagged

Cat.No. : BCAR1-121H
Product Overview : Human BCAR1 partial ORF ( NP_055382, 771 a.a. - 870 a.a.) recombinant protein with GST-tag at N-terminal.
Description : BCAR1, or CAS, is an Src (MIM 190090) family kinase substrate involved in various cellular events, including migration, survival, transformation, and invasion (Sawada et al., 2006 [PubMed 17129785]).
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : TNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPSAAQDMVERVKELGHSTQQFRRVLGQLAAA
Purity : Glutathione Sepharose 4 Fast Flow
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : BCAR1 breast cancer anti-estrogen resistance 1 [ Homo sapiens ]
Official Symbol : BCAR1
Synonyms : BCAR1; breast cancer anti-estrogen resistance 1; breast cancer anti-estrogen resistance protein 1; CAS; Cas scaffolding protein family member 1; CASS1; Crk associated substrate; Crkas; P130Cas; Crk-associated substrate p130Cas; CAS1; CRKAS; FLJ12176; FLJ45059;
Gene ID : 9564
mRNA Refseq : NM_001170714
Protein Refseq : NP_001164185
MIM : 602941
UniProt ID : P56945

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.