Recombinant Human BCAR1 Protein, GST-tagged
Cat.No. : | BCAR1-121H |
Product Overview : | Human BCAR1 partial ORF ( NP_055382, 771 a.a. - 870 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | BCAR1, or CAS, is an Src (MIM 190090) family kinase substrate involved in various cellular events, including migration, survival, transformation, and invasion (Sawada et al., 2006 [PubMed 17129785]). |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | TNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPSAAQDMVERVKELGHSTQQFRRVLGQLAAA |
Purity : | Glutathione Sepharose 4 Fast Flow |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BCAR1 breast cancer anti-estrogen resistance 1 [ Homo sapiens ] |
Official Symbol | BCAR1 |
Synonyms | BCAR1; breast cancer anti-estrogen resistance 1; breast cancer anti-estrogen resistance protein 1; CAS; Cas scaffolding protein family member 1; CASS1; Crk associated substrate; Crkas; P130Cas; Crk-associated substrate p130Cas; CAS1; CRKAS; FLJ12176; FLJ45059; |
Gene ID | 9564 |
mRNA Refseq | NM_001170714 |
Protein Refseq | NP_001164185 |
MIM | 602941 |
UniProt ID | P56945 |
◆ Recombinant Proteins | ||
BCAR1-950R | Recombinant Rat BCAR1 Protein | +Inquiry |
BCAR1-1598HF | Recombinant Full Length Human BCAR1 Protein, GST-tagged | +Inquiry |
BCAR1-121H | Recombinant Human BCAR1 Protein, GST-tagged | +Inquiry |
Bcar1-1840M | Recombinant Mouse Bcar1 Protein, Myc/DDK-tagged | +Inquiry |
BCAR1-608R | Recombinant Rat BCAR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCAR1-8498HCL | Recombinant Human BCAR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCAR1 Products
Required fields are marked with *
My Review for All BCAR1 Products
Required fields are marked with *