Recombinant Human BCAR1 Protein, GST-tagged

Cat.No. : BCAR1-121H
Product Overview : Human BCAR1 partial ORF ( NP_055382, 771 a.a. - 870 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : BCAR1, or CAS, is an Src (MIM 190090) family kinase substrate involved in various cellular events, including migration, survival, transformation, and invasion (Sawada et al., 2006 [PubMed 17129785]).
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : TNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPSAAQDMVERVKELGHSTQQFRRVLGQLAAA
Purity : Glutathione Sepharose 4 Fast Flow
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BCAR1 breast cancer anti-estrogen resistance 1 [ Homo sapiens ]
Official Symbol BCAR1
Synonyms BCAR1; breast cancer anti-estrogen resistance 1; breast cancer anti-estrogen resistance protein 1; CAS; Cas scaffolding protein family member 1; CASS1; Crk associated substrate; Crkas; P130Cas; Crk-associated substrate p130Cas; CAS1; CRKAS; FLJ12176; FLJ45059;
Gene ID 9564
mRNA Refseq NM_001170714
Protein Refseq NP_001164185
MIM 602941
UniProt ID P56945

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCAR1 Products

Required fields are marked with *

My Review for All BCAR1 Products

Required fields are marked with *

0
cart-icon