Recombinant Human BCAS2 protein, T7-tagged
| Cat.No. : | BCAS2-142H |
| Product Overview : | Recombinant human BCAS2 (225 aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | T7 |
| Protein Length : | 225 a.a. |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGEFMAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSA FETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAW KVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIK QQHGEANKENIRQDF |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro wild-type P53 mediated cancer cell apoptosis regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping BCAS2 protein-protein interaction.4. May be used as antigen for specific antibody development. |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | BCAS2 breast carcinoma amplified sequence 2 [ Homo sapiens ] |
| Official Symbol | BCAS2 |
| Synonyms | BCAS2; breast carcinoma amplified sequence 2; pre-mRNA-splicing factor SPF27; DAM1; Snt309; SPF27; breast carcinoma-amplified sequence 2; spliceosome-associated protein SPF 27; DNA amplified in mammary carcinoma 1 protein; spliceosome associated protein, amplified in breast cancer; |
| Gene ID | 10286 |
| mRNA Refseq | NM_005872 |
| Protein Refseq | NP_005863 |
| MIM | 605783 |
| UniProt ID | O75934 |
| Chromosome Location | 1p13.2 |
| Pathway | Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem; Spliceosome, Prp19/CDC5L complex, organism-specific biosystem; |
| ◆ Recombinant Proteins | ||
| BCAS2-301H | Recombinant Human BCAS2 Protein, His-tagged | +Inquiry |
| BCAS2-414H | Recombinant Human BCAS2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| BCAS2-27440TH | Recombinant Human BCAS2, T7 -tagged | +Inquiry |
| Bcas2-1843M | Recombinant Mouse Bcas2 Protein, Myc/DDK-tagged | +Inquiry |
| BCAS2-126H | Recombinant Human BCAS2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCAS2-8496HCL | Recombinant Human BCAS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCAS2 Products
Required fields are marked with *
My Review for All BCAS2 Products
Required fields are marked with *
