Recombinant Human BCAS2 protein, T7-tagged

Cat.No. : BCAS2-142H
Product Overview : Recombinant human BCAS2 (225 aa) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 225 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFMAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSA FETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAW KVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIK QQHGEANKENIRQDF
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro wild-type P53 mediated cancer cell apoptosis regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping BCAS2 protein-protein interaction.4. May be used as antigen for specific antibody development.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name BCAS2 breast carcinoma amplified sequence 2 [ Homo sapiens ]
Official Symbol BCAS2
Synonyms BCAS2; breast carcinoma amplified sequence 2; pre-mRNA-splicing factor SPF27; DAM1; Snt309; SPF27; breast carcinoma-amplified sequence 2; spliceosome-associated protein SPF 27; DNA amplified in mammary carcinoma 1 protein; spliceosome associated protein, amplified in breast cancer;
Gene ID 10286
mRNA Refseq NM_005872
Protein Refseq NP_005863
MIM 605783
UniProt ID O75934
Chromosome Location 1p13.2
Pathway Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem; Spliceosome, Prp19/CDC5L complex, organism-specific biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCAS2 Products

Required fields are marked with *

My Review for All BCAS2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon