"BCAS2" Related Products

Expand
Expand
Expand

Recombinant Human BCAS2 protein, T7-tagged

Cat.No.: BCAS2-142H
Product Overview: Recombinant human BCAS2 (225 aa) fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFMAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSA FETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAW KVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIK QQHGEANKENIRQDF
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro wild-type P53 mediated cancer cell apoptosis regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping BCAS2 protein-protein interaction.4. May be used as antigen for specific antibody development.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: BCAS2 breast carcinoma amplified sequence 2 [ Homo sapiens ]
Official Symbol: BCAS2
Synonyms: BCAS2; breast carcinoma amplified sequence 2; pre-mRNA-splicing factor SPF27; DAM1; Snt309; SPF27; breast carcinoma-amplified sequence 2; spliceosome-associated protein SPF 27; DNA amplified in mammary carcinoma 1 protein; spliceosome associated protein, amplified in breast cancer;
Gene ID: 10286
mRNA Refseq: NM_005872
Protein Refseq: NP_005863
MIM: 605783
UniProt ID: O75934
Chromosome Location: 1p13.2
Pathway: Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem; Spliceosome, Prp19/CDC5L complex, organism-specific biosystem;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.