Recombinant Human BCKDHA Protein, GST-tagged
| Cat.No. : | BCKDHA-136H |
| Product Overview : | Human BCKDHA partial ORF ( NP_000700, 347 a.a. - 445 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The branched-chain alpha-keto acid (BCAA) dehydrogenase (BCKD) complex is an innter mitochondrial enzyme complex that catalyzes the second major step in the catabolism of the branched-chain amino acids leucine, isoleucine, and valine. The BCKD complex consists of three catalytic components: a heterotetrameric (alpha2-beta2) branched-chain alpha-keto acid decarboxylase (E1), a dihydrolipoyl transacylase (E2), and a dihydrolipoamide dehydrogenase (E3). This gene encodes the alpha subunit of the decarboxylase (E1) component. Mutations in this gene result in maple syrup urine disease, type IA. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | SVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDHFDK |
| Purity : | Glutathione Sepharose 4 Fast Flow |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BCKDHA branched chain keto acid dehydrogenase E1, alpha polypeptide [ Homo sapiens ] |
| Official Symbol | BCKDHA |
| Synonyms | BCKDHA; branched chain keto acid dehydrogenase E1, alpha polypeptide; 2 oxoisovalerate dehydrogenase (lipoamide) , branched chain keto acid dehydrogenase E1, alpha polypeptide (maple syrup urine disease) , OVD1A; 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial; maple syrup urine disease; MSU; BCKDH E1-alpha; 2-oxoisovalerate dehydrogenase (lipoamide); branched-chain alpha-keto acid dehydrogenase E1 component alpha chain; MSUD1; OVD1A; BCKDE1A; FLJ45695; |
| Gene ID | 593 |
| mRNA Refseq | NM_000709 |
| Protein Refseq | NP_000700 |
| MIM | 608348 |
| UniProt ID | P12694 |
| ◆ Recombinant Proteins | ||
| BCKDHA-962H | Recombinant Human BCKDHA | +Inquiry |
| BCKDHA-86C | Recombinant Cynomolgus Monkey BCKDHA Protein, His (Fc)-Avi-tagged | +Inquiry |
| BCKDHA-27439TH | Recombinant Human BCKDHA, His-tagged | +Inquiry |
| BCKDHA-338C | Recombinant Cynomolgus BCKDHA Protein, His-tagged | +Inquiry |
| BCKDHA-136H | Recombinant Human BCKDHA Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCKDHA-163HCL | Recombinant Human BCKDHA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCKDHA Products
Required fields are marked with *
My Review for All BCKDHA Products
Required fields are marked with *
