| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
210 |
| Description : |
This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Alternative splicing results in multiple transcript variants. |
| Form : |
0.2 µm filtered concentrated solution in 25 mM Tris-HCl, pH 8.0, 100mM NaCl, 1 mM DTT, 30 % Glycerol, with Tween-80. |
| Molecular Mass : |
Approximately 23.2 kDa, a single non-glycosylated polypeptide chain containing 210 amino acids. |
| AA Sequence : |
AHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD |
| Endotoxin : |
Less than 0.1 EU/µg of rHuBcl-2 as determined by LAL method. |
| Purity : |
>95% by SDS-PAGE and HPLC analyses. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening. |