Recombinant Human BCL2 protein

Cat.No. : BCL2-76H
Product Overview : Recombinant Human BCL2 protein was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 210
Description : This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Alternative splicing results in multiple transcript variants.
Form : 0.2 µm filtered concentrated solution in 25 mM Tris-HCl, pH 8.0, 100mM NaCl, 1 mM DTT, 30 % Glycerol, with Tween-80.
Molecular Mass : Approximately 23.2 kDa, a single non-glycosylated polypeptide chain containing 210 amino acids.
AA Sequence : AHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD
Endotoxin : Less than 0.1 EU/µg of rHuBcl-2 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analyses.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening.
Gene Name BCL2
Official Symbol BCL2
Synonyms BCL2; B-cell CLL/lymphoma 2; apoptosis regulator Bcl-2; Bcl 2; PPP1R50; protein phosphatase 1; regulatory subunit 50; protein phosphatase 1, regulatory subunit 50; Bcl-2;
Gene ID 596
mRNA Refseq NM_000633
Protein Refseq NP_000624
MIM 600039
UniProt ID P10415

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCL2 Products

Required fields are marked with *

My Review for All BCL2 Products

Required fields are marked with *

0
cart-icon