Recombinant Human BCL2A1 Protein, GST-tagged

• Cat.No.: BCL2A1-146H
• Product Overview: Human BCL2A1 partial ORF ( AAH16281, 31 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities such as embryonic development, homeostasis and tumorigenesis. The protein encoded by this gene is able to reduce the release of pro-apoptotic cytochrome c from mitochondria and block caspase activation. This gene is a direct transcription target of NF-kappa B in response to inflammatory mediators, and is up-regulated by different extracellular signals, such as granulocyte-macrophage colony-stimulating factor (GM-CSF), CD40, phorbol ester and inflammatory cytokine TNF and IL-1, which suggests a cytoprotective function that is essential for lymphocyte activation as well as cell survival. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.63 kDa
• AA Sequence: SKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNT
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BCL2A1 BCL2-related protein A1 [ Homo sapiens ]
• Official Symbol: BCL2A1
• Synonyms: BCL2A1; BCL2-related protein A1; HBPA1; bcl-2-related protein A1; ACC 1; ACC 2; BCL2L5; BFL1; GRS; bcl2-L-5; protein BFL-1; bcl-2-like protein 5; hematopoietic BCL2-related protein A1; hemopoietic-specific early response protein; ACC-1; ACC-2
• Gene ID: 597
• mRNA Refseq: NM_001114735
• Protein Refseq: NP_001108207
• MIM: 601056
• UniProt ID: Q16548