Recombinant Human BCL2A1 protein, His-tagged
Cat.No. : | BCL2A1-2842H |
Product Overview : | Recombinant Human BCL2A1 protein(27 - 83 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 27 - 83 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGI |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | BCL2A1 BCL2-related protein A1 [ Homo sapiens ] |
Official Symbol | BCL2A1 |
Synonyms | BCL2A1; BCL2-related protein A1; HBPA1; bcl-2-related protein A1; ACC 1; ACC 2; BCL2L5; BFL1; GRS; bcl2-L-5; protein BFL-1; bcl-2-like protein 5; hematopoietic BCL2-related protein A1; hemopoietic-specific early response protein; ACC-1; ACC-2; |
Gene ID | 597 |
mRNA Refseq | NM_001114735 |
Protein Refseq | NP_001108207 |
MIM | 601056 |
UniProt ID | Q16548 |
◆ Recombinant Proteins | ||
BCL2A1-305H | Recombinant Human BCL2A1 Protein, His-tagged | +Inquiry |
BCL2A1-6774H | Recombinant Human BCL2-related Protein A1, His-tagged | +Inquiry |
BCL2A1-298H | Recombinant Human Bcl2A1 protein, His-tagged | +Inquiry |
BCL2A1-146H | Recombinant Human BCL2A1 Protein, GST-tagged | +Inquiry |
BCL2A1-1590HF | Recombinant Full Length Human BCL2A1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCL2A1-59HCL | Recombinant Human BCL2A1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCL2A1 Products
Required fields are marked with *
My Review for All BCL2A1 Products
Required fields are marked with *
0
Inquiry Basket