Recombinant Human BCL2A1 protein, His-GST-tagged

Cat.No. : BCL2A1-7321H
Product Overview : Recombinant Human BCL2A1 protein(Q16548)(1-175aa), fused with N-terminal His and GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 1-175aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 61.3 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : VLFQGPLGSPEFRTMTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYCGRTRAPPPPPLRSGCQSPKGSVGCCHRAITSITPWGLTGLEGVFCKENYIRIAWRHVADIDRGRCGDSPIRTGYS
Gene Name BCL2A1 BCL2-related protein A1 [ Homo sapiens ]
Official Symbol BCL2A1
Synonyms BCL2A1; BCL2-related protein A1; HBPA1; bcl-2-related protein A1; ACC 1; ACC 2; BCL2L5; BFL1; GRS; bcl2-L-5; protein BFL-1; bcl-2-like protein 5; hematopoietic BCL2-related protein A1; hemopoietic-specific early response protein; ACC-1; ACC-2;
Gene ID 597
mRNA Refseq NM_001114735
Protein Refseq NP_001108207
MIM 601056
UniProt ID Q16548

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCL2A1 Products

Required fields are marked with *

My Review for All BCL2A1 Products

Required fields are marked with *

0
cart-icon