Recombinant Human BCL2A1 protein, His-GST-tagged
Cat.No. : | BCL2A1-7321H |
Product Overview : | Recombinant Human BCL2A1 protein(Q16548)(1-175aa), fused with N-terminal His and GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 1-175aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 61.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | VLFQGPLGSPEFRTMTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYCGRTRAPPPPPLRSGCQSPKGSVGCCHRAITSITPWGLTGLEGVFCKENYIRIAWRHVADIDRGRCGDSPIRTGYS |
Gene Name | BCL2A1 BCL2-related protein A1 [ Homo sapiens ] |
Official Symbol | BCL2A1 |
Synonyms | BCL2A1; BCL2-related protein A1; HBPA1; bcl-2-related protein A1; ACC 1; ACC 2; BCL2L5; BFL1; GRS; bcl2-L-5; protein BFL-1; bcl-2-like protein 5; hematopoietic BCL2-related protein A1; hemopoietic-specific early response protein; ACC-1; ACC-2; |
Gene ID | 597 |
mRNA Refseq | NM_001114735 |
Protein Refseq | NP_001108207 |
MIM | 601056 |
UniProt ID | Q16548 |
◆ Recombinant Proteins | ||
BCL2A1-2534H | Recombinant Human BCL2A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BCL2A1-510H | Recombinant Human BCL2A1 | +Inquiry |
BCL2A1-3166H | Recombinant Human BCL2A1 protein, His-tagged | +Inquiry |
BCL2A1-6774H | Recombinant Human BCL2-related Protein A1, His-tagged | +Inquiry |
BCL2A1-1590HF | Recombinant Full Length Human BCL2A1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCL2A1-59HCL | Recombinant Human BCL2A1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCL2A1 Products
Required fields are marked with *
My Review for All BCL2A1 Products
Required fields are marked with *
0
Inquiry Basket