Recombinant Human BCL2A1 protein, His-GST-tagged

• Cat.No.: BCL2A1-7321H
• Product Overview: Recombinant Human BCL2A1 protein(Q16548)(1-175aa), fused with N-terminal His and GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His
• Protein Length: 1-175aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 61.3 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: VLFQGPLGSPEFRTMTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYCGRTRAPPPPPLRSGCQSPKGSVGCCHRAITSITPWGLTGLEGVFCKENYIRIAWRHVADIDRGRCGDSPIRTGYS

Gene Information

• Gene Name: BCL2A1 BCL2-related protein A1 [ Homo sapiens ]
• Official Symbol: BCL2A1
• Synonyms: BCL2A1; BCL2-related protein A1; HBPA1; bcl-2-related protein A1; ACC 1; ACC 2; BCL2L5; BFL1; GRS; bcl2-L-5; protein BFL-1; bcl-2-like protein 5; hematopoietic BCL2-related protein A1; hemopoietic-specific early response protein; ACC-1; ACC-2
• Gene ID: 597
• mRNA Refseq: NM_001114735
• Protein Refseq: NP_001108207
• MIM: 601056
• UniProt ID: Q16548