Recombinant Human BCL2L11 protein, His-SUMO-tagged
Cat.No. : | BCL2L11-2582H |
Product Overview : | Recombinant Human BCL2L11 protein(O43521)(1-198aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-198aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38.2 kDa |
AA Sequence : | MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | BCL2L11 BCL2-like 11 (apoptosis facilitator) [ Homo sapiens ] |
Official Symbol | BCL2L11 |
Synonyms | BCL2L11; BCL2-like 11 (apoptosis facilitator); bcl-2-like protein 11; BIM; BimEL; BimL; BOD; bcl2-L-11; bcl-2 interacting protein Bim; bcl-2-related ovarian death agonist; bcl-2 interacting mediator of cell death; BAM; BIM-beta6; BIM-beta7; BIM-alpha6; |
Gene ID | 10018 |
mRNA Refseq | NM_001204106 |
Protein Refseq | NP_001191035 |
MIM | 603827 |
UniProt ID | O43521 |
◆ Recombinant Proteins | ||
BCL2L11-618R | Recombinant Rat BCL2L11 Protein, His (Fc)-Avi-tagged | +Inquiry |
BCL2L11-133H | Recombinant Human BCL2L11 protein(Ala2-Arg120), His-tagged | +Inquiry |
BCL2L11-2344M | Recombinant Mouse BCL2L11 Protein | +Inquiry |
BCL2L11-7198Z | Recombinant Zebrafish BCL2L11 | +Inquiry |
BCL2L11-1578H | Recombinant Human BCL2-Like 11 (Apoptosis Facilitator) | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCL2L11-60HCL | Recombinant Human BCL2L11 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCL2L11 Products
Required fields are marked with *
My Review for All BCL2L11 Products
Required fields are marked with *
0
Inquiry Basket