Recombinant Human BCL2L12 Protein, GST-tagged
| Cat.No. : | BCL2L12-152H |
| Product Overview : | Human BCL2L12 full-length ORF ( NP_001035758.1, 1 a.a. - 333 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains a Bcl-2 homology domain 2 (BH2). The function of this gene has not yet been determined. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 63.1 kDa |
| AA Sequence : | MGRPAGLFPPLCPFLGFRPEACWERHMQIERAPSVPPFLRWAGYRPGPVRRRGKVELIKFVRVQWRRPQVEWRRRRWGPGPGASMAGSEELGLREDTLRVLAAFLRRGEAAGSPVPTPPSPAQEEPTDFLSRLRRCLPCSLGRGAAPSESPRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLVALLEEEAEVINQKLASDPALRSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARLALAMELSRRVAGLGGTLAGLSVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BCL2L12 BCL2-like 12 (proline rich) [ Homo sapiens ] |
| Official Symbol | BCL2L12 |
| Synonyms | BCL2L12; BCL2-like 12 (proline rich); bcl-2-like protein 12; bcl2-L-12; Bcl-2 related proline-rich protein; bcl-2-related proline-rich protein; MGC120313; MGC120314; MGC120315; |
| Gene ID | 83596 |
| mRNA Refseq | NM_001040668 |
| Protein Refseq | NP_001035758 |
| MIM | 610837 |
| UniProt ID | Q9HB09 |
| ◆ Recombinant Proteins | ||
| BCL2L12-153H | Recombinant Human BCL2L12 Protein, GST-tagged | +Inquiry |
| BCL2L12-1599HF | Recombinant Full Length Human BCL2L12 Protein, GST-tagged | +Inquiry |
| BCL2L12-2821H | Recombinant Human BCL2L12 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| BCL2L12-152H | Recombinant Human BCL2L12 Protein, GST-tagged | +Inquiry |
| Bcl2l12-1847M | Recombinant Mouse Bcl2l12 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCL2L12-8486HCL | Recombinant Human BCL2L12 293 Cell Lysate | +Inquiry |
| BCL2L12-8487HCL | Recombinant Human BCL2L12 293 Cell Lysate | +Inquiry |
| BCL2L12-071HKCL | Human BCL2L12 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCL2L12 Products
Required fields are marked with *
My Review for All BCL2L12 Products
Required fields are marked with *
