Recombinant Human BCL2L12 Protein, GST-tagged

Cat.No. : BCL2L12-152H
Product Overview : Human BCL2L12 full-length ORF ( NP_001035758.1, 1 a.a. - 333 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains a Bcl-2 homology domain 2 (BH2). The function of this gene has not yet been determined. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 63.1 kDa
AA Sequence : MGRPAGLFPPLCPFLGFRPEACWERHMQIERAPSVPPFLRWAGYRPGPVRRRGKVELIKFVRVQWRRPQVEWRRRRWGPGPGASMAGSEELGLREDTLRVLAAFLRRGEAAGSPVPTPPSPAQEEPTDFLSRLRRCLPCSLGRGAAPSESPRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLVALLEEEAEVINQKLASDPALRSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARLALAMELSRRVAGLGGTLAGLSVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BCL2L12 BCL2-like 12 (proline rich) [ Homo sapiens ]
Official Symbol BCL2L12
Synonyms BCL2L12; BCL2-like 12 (proline rich); bcl-2-like protein 12; bcl2-L-12; Bcl-2 related proline-rich protein; bcl-2-related proline-rich protein; MGC120313; MGC120314; MGC120315;
Gene ID 83596
mRNA Refseq NM_001040668
Protein Refseq NP_001035758
MIM 610837
UniProt ID Q9HB09

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCL2L12 Products

Required fields are marked with *

My Review for All BCL2L12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon