Recombinant Human BCL2L12 Protein, GST-tagged
Cat.No. : | BCL2L12-153H |
Product Overview : | Human BCL2L12 partial ORF ( AAH07724, 174 a.a. - 273 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains a Bcl-2 homology domain 2 (BH2). The function of this gene has not yet been determined. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq] |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | RSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPSPPSPEPLARLALAMELSRRVAGLGGTLAGLSVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BCL2L12 BCL2-like 12 (proline rich) [ Homo sapiens ] |
Official Symbol | BCL2L12 |
Synonyms | BCL2L12; BCL2-like 12 (proline rich); bcl-2-like protein 12; bcl2-L-12; Bcl-2 related proline-rich protein; bcl-2-related proline-rich protein; MGC120313; MGC120314; MGC120315; |
Gene ID | 83596 |
mRNA Refseq | NM_001040668 |
Protein Refseq | NP_001035758 |
MIM | 610837 |
UniProt ID | Q9HB09 |
◆ Recombinant Proteins | ||
BCL2L12-2821H | Recombinant Human BCL2L12 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BCL2L12-1599HF | Recombinant Full Length Human BCL2L12 Protein, GST-tagged | +Inquiry |
BCL2L12-153H | Recombinant Human BCL2L12 Protein, GST-tagged | +Inquiry |
BCL2L12-152H | Recombinant Human BCL2L12 Protein, GST-tagged | +Inquiry |
Bcl2l12-1847M | Recombinant Mouse Bcl2l12 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCL2L12-8487HCL | Recombinant Human BCL2L12 293 Cell Lysate | +Inquiry |
BCL2L12-8486HCL | Recombinant Human BCL2L12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCL2L12 Products
Required fields are marked with *
My Review for All BCL2L12 Products
Required fields are marked with *
0
Inquiry Basket