Recombinant Human BCL6 Protein, GST-tagged

• Cat.No.: BCL6-158H
• Product Overview: Recombinant human BCL6 protein with a GST-tag was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Description: The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal POZ domain. This protein acts as a sequence-specific repressor of transcription, and has been shown to modulate the transcription of STAT-dependent IL-4 responses of B cells. This protein can interact with a variety of POZ-containing proteins that function as transcription corepressors. This gene is found to be frequently translocated and hypermutated in diffuse large-cell lymphoma (DLCL), and may be involved in the pathogenesis of DLCL. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.
• Molecular Mass: The protein has a calculated MW of 43 kDa.
• AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFMASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCRKFIKASEAEMVSAIKPPREEFLNSRMLM
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.629 mg/mL
• Storage Buffer: 50mM Tris, 10mM GSH pH7.5

Gene Information

• Gene Name: BCL6 B-cell CLL/lymphoma 6 [ Homo sapiens (human) ]
• Official Symbol: BCL6
• Synonyms: BCL6; B-cell CLL/lymphoma 6; zinc finger protein 51 , ZNF51; B-cell lymphoma 6 protein; BCL5; BCL6A; LAZ3; ZBTB27; BCL-5; BCL-6; protein LAZ-3; zinc finger protein 51; B-cell lymphoma 5 protein; B-cell lymphoma 6 protein transcript; zinc finger transcription factor BCL6S; cys-his2 zinc finger transcription factor; zinc finger and BTB domain-containing protein 27; lymphoma-associated zinc finger gene on chromosome 3; ZNF51
• Gene ID: 604
• mRNA Refseq: NM_001130845
• Protein Refseq: NP_001124317
• MIM: 109565
• UniProt ID: P41182