Recombinant Human BCL6 Protein, GST-tagged

Cat.No. : BCL6-158H
Product Overview : Recombinant human BCL6 protein with a GST-tag was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Description : The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal POZ domain. This protein acts as a sequence-specific repressor of transcription, and has been shown to modulate the transcription of STAT-dependent IL-4 responses of B cells. This protein can interact with a variety of POZ-containing proteins that function as transcription corepressors. This gene is found to be frequently translocated and hypermutated in diffuse large-cell lymphoma (DLCL), and may be involved in the pathogenesis of DLCL. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.
Molecular Mass : The protein has a calculated MW of 43 kDa.
AA Sequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFMASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCRKFIKASEAEMVSAIKPPREEFLNSRMLM
Purity : >90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.629 mg/mL
Storage Buffer : 50mM Tris, 10mM GSH pH7.5
Gene Name BCL6 B-cell CLL/lymphoma 6 [ Homo sapiens (human) ]
Official Symbol BCL6
Synonyms BCL6; B-cell CLL/lymphoma 6; zinc finger protein 51 , ZNF51; B-cell lymphoma 6 protein; BCL5; BCL6A; LAZ3; ZBTB27; BCL-5; BCL-6; protein LAZ-3; zinc finger protein 51; B-cell lymphoma 5 protein; B-cell lymphoma 6 protein transcript; zinc finger transcription factor BCL6S; cys-his2 zinc finger transcription factor; zinc finger and BTB domain-containing protein 27; lymphoma-associated zinc finger gene on chromosome 3; ZNF51;
Gene ID 604
mRNA Refseq NM_001130845
Protein Refseq NP_001124317
MIM 109565
UniProt ID P41182

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCL6 Products

Required fields are marked with *

My Review for All BCL6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon