Recombinant Human BCL6B Protein, GST-tagged
| Cat.No. : | BCL6B-161H |
| Product Overview : | Human BCL6B partial ORF ( NP_862827, 248 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.52 kDa |
| AA Sequence : | GPIPGPQSRLSPTAATVQFKCGAPASTPYLLTSQAQDTSGSPSERARPLPGSEFFSCQNCEAVAGCSSGLDSLVPGDEDKPYKCQLCRSSFRYKGNLA |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BCL6B B-cell CLL/lymphoma 6, member B (zinc finger protein) [ Homo sapiens ] |
| Official Symbol | BCL6B |
| Synonyms | BCL6B; B-cell CLL/lymphoma 6, member B (zinc finger protein); B cell CLL/lymphoma 6, member B (zinc finger protein) , zinc finger protein 62 , ZNF62; BAZF; ZBTB28; |
| Gene ID | 27188 |
| MIM | 608992 |
| UniProt ID | Q8N143 |
| ◆ Recombinant Proteins | ||
| BCL6B-10186H | Recombinant Human BCL6B, His-tagged | +Inquiry |
| BCL6B-161H | Recombinant Human BCL6B Protein, GST-tagged | +Inquiry |
| BCL6B-1548HF | Recombinant Full Length Human BCL6B Protein, GST-tagged | +Inquiry |
| BCL6B-2352M | Recombinant Mouse BCL6B Protein | +Inquiry |
| BCL6B-997M | Recombinant Mouse BCL6B Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCL6B-8478HCL | Recombinant Human BCL6B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCL6B Products
Required fields are marked with *
My Review for All BCL6B Products
Required fields are marked with *
