Recombinant Human BCL7A protein, His-tagged

• Cat.No.: BCL7A-6433H
• Product Overview: Recombinant Human BCL7A protein(Q4VC05)(1-210aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1-210aa
• Tag: C-His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 24.3 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEPKVDDKNKNKKKGKDEKCGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSEEM

Gene Information

• Gene Name: BCL7A B-cell CLL/lymphoma 7A [ Homo sapiens ]
• Official Symbol: BCL7A
• Synonyms: BCL7A; B-cell CLL/lymphoma 7A; BCL7; B-cell CLL/lymphoma 7 protein family member A; B-cell CLL/lymphoma-7
• Gene ID: 605
• mRNA Refseq: NM_001024808
• Protein Refseq: NP_001019979
• MIM: 601406
• UniProt ID: Q4VC05