Recombinant Human BCL7A protein, His-tagged

Cat.No. : BCL7A-6433H
Product Overview : Recombinant Human BCL7A protein(Q4VC05)(1-210aa), fused with C-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 1-210aa
Tag : C-His
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 24.3 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEPKVDDKNKNKKKGKDEKCGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSEEM
Gene Name BCL7A B-cell CLL/lymphoma 7A [ Homo sapiens ]
Official Symbol BCL7A
Synonyms BCL7A; B-cell CLL/lymphoma 7A; BCL7; B-cell CLL/lymphoma 7 protein family member A; B-cell CLL/lymphoma-7;
Gene ID 605
mRNA Refseq NM_001024808
Protein Refseq NP_001019979
MIM 601406
UniProt ID Q4VC05

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCL7A Products

Required fields are marked with *

My Review for All BCL7A Products

Required fields are marked with *

0
cart-icon
0
compare icon