Recombinant Human BCL7A protein, His-tagged
Cat.No. : | BCL7A-6433H |
Product Overview : | Recombinant Human BCL7A protein(Q4VC05)(1-210aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-210aa |
Tag : | C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.3 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEPKVDDKNKNKKKGKDEKCGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSEEM |
Gene Name | BCL7A B-cell CLL/lymphoma 7A [ Homo sapiens ] |
Official Symbol | BCL7A |
Synonyms | BCL7A; B-cell CLL/lymphoma 7A; BCL7; B-cell CLL/lymphoma 7 protein family member A; B-cell CLL/lymphoma-7; |
Gene ID | 605 |
mRNA Refseq | NM_001024808 |
Protein Refseq | NP_001019979 |
MIM | 601406 |
UniProt ID | Q4VC05 |
◆ Recombinant Proteins | ||
BCL7A-163H | Recombinant Human BCL7A Protein, GST-tagged | +Inquiry |
BCL7A-768H | Recombinant Human BCL7A Protein, His-tagged | +Inquiry |
BCL7A-2353M | Recombinant Mouse BCL7A Protein | +Inquiry |
BCL7A-6433H | Recombinant Human BCL7A protein, His-tagged | +Inquiry |
BCL7A-1550HF | Recombinant Full Length Human BCL7A Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCL7A Products
Required fields are marked with *
My Review for All BCL7A Products
Required fields are marked with *
0
Inquiry Basket