Recombinant Human BCL7A Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : BCL7A-051H
Product Overview : BCL7A MS Standard C13 and N15-labeled recombinant protein (NP_001019979) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is directly involved, with Myc and IgH, in a three-way gene translocation in a Burkitt lymphoma cell line. As a result of the gene translocation, the N-terminal region of the gene product is disrupted, which is thought to be related to the pathogenesis of a subset of high-grade B cell non-Hodgkin lymphoma. The N-terminal segment involved in the translocation includes the region that shares a strong sequence similarity with those of BCL7B and BCL7C. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 22.8 kDa
AA Sequence : MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEPKVDDKNKNKKKGKDEKCGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSEEMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name BCL7A BAF chromatin remodeling complex subunit BCL7A [ Homo sapiens (human) ]
Official Symbol BCL7A
Synonyms BCL7A; BAF chromatin remodeling complex subunit BCL7A; BCL7; B-cell CLL/lymphoma 7 protein family member A; B-cell CLL/lymphoma 7A; B-cell CLL/lymphoma-7; BCL tumor suppressor 7A; BCL7A, BAF complex component
Gene ID 605
mRNA Refseq NM_001024808
Protein Refseq NP_001019979
MIM 601406
UniProt ID Q4VC05

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCL7A Products

Required fields are marked with *

My Review for All BCL7A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon