Recombinant Human BCL7A Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: BCL7A-051H
• Product Overview: BCL7A MS Standard C13 and N15-labeled recombinant protein (NP_001019979) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene is directly involved, with Myc and IgH, in a three-way gene translocation in a Burkitt lymphoma cell line. As a result of the gene translocation, the N-terminal region of the gene product is disrupted, which is thought to be related to the pathogenesis of a subset of high-grade B cell non-Hodgkin lymphoma. The N-terminal segment involved in the translocation includes the region that shares a strong sequence similarity with those of BCL7B and BCL7C. Two transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 22.8 kDa
• AA Sequence: MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEPKVDDKNKNKKKGKDEKCGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSEEMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: BCL7A BAF chromatin remodeling complex subunit BCL7A [ Homo sapiens (human) ]
• Official Symbol: BCL7A
• Synonyms: BCL7A; BAF chromatin remodeling complex subunit BCL7A; BCL7; B-cell CLL/lymphoma 7 protein family member A; B-cell CLL/lymphoma 7A; B-cell CLL/lymphoma-7; BCL tumor suppressor 7A; BCL7A, BAF complex component
• Gene ID: 605
• mRNA Refseq: NM_001024808
• Protein Refseq: NP_001019979
• MIM: 601406
• UniProt ID: Q4VC05