Recombinant Human BCL7A Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | BCL7A-051H |
Product Overview : | BCL7A MS Standard C13 and N15-labeled recombinant protein (NP_001019979) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is directly involved, with Myc and IgH, in a three-way gene translocation in a Burkitt lymphoma cell line. As a result of the gene translocation, the N-terminal region of the gene product is disrupted, which is thought to be related to the pathogenesis of a subset of high-grade B cell non-Hodgkin lymphoma. The N-terminal segment involved in the translocation includes the region that shares a strong sequence similarity with those of BCL7B and BCL7C. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 22.8 kDa |
AA Sequence : | MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEPKVDDKNKNKKKGKDEKCGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSEEMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | BCL7A BAF chromatin remodeling complex subunit BCL7A [ Homo sapiens (human) ] |
Official Symbol | BCL7A |
Synonyms | BCL7A; BAF chromatin remodeling complex subunit BCL7A; BCL7; B-cell CLL/lymphoma 7 protein family member A; B-cell CLL/lymphoma 7A; B-cell CLL/lymphoma-7; BCL tumor suppressor 7A; BCL7A, BAF complex component |
Gene ID | 605 |
mRNA Refseq | NM_001024808 |
Protein Refseq | NP_001019979 |
MIM | 601406 |
UniProt ID | Q4VC05 |
◆ Recombinant Proteins | ||
BCL7A-7854H | Recombinant Human BCL7A protein, GST-tagged | +Inquiry |
BCL7A-5634H | Recombinant Human BCL7A protein, His&Myc-tagged | +Inquiry |
BCL7A-2465H | Recombinant Human BCL7A Protein, MYC/DDK-tagged | +Inquiry |
BCL7A-998M | Recombinant Mouse BCL7A Protein, His (Fc)-Avi-tagged | +Inquiry |
BCL7A-1550HF | Recombinant Full Length Human BCL7A Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCL7A Products
Required fields are marked with *
My Review for All BCL7A Products
Required fields are marked with *
0
Inquiry Basket