Recombinant Human BCL7B Protein, GST-tagged

Cat.No. : BCL7B-165H
Product Overview : Human BCL7B partial ORF ( NP_001698, 124 a.a. - 202 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene contains a region that is highly similar to the N-terminal segment of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. This gene is located at a chromosomal region commonly deleted in Williams syndrome. The function of this gene has not yet been determined. [provided by RefSeq]
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 34.43 kDa
AA Sequence : AHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BCL7B B-cell CLL/lymphoma 7B [ Homo sapiens ]
Official Symbol BCL7B
Synonyms BCL7B; B-cell CLL/lymphoma 7B; B-cell CLL/lymphoma 7 protein family member B;
Gene ID 9275
mRNA Refseq NM_001197244
Protein Refseq NP_001184173
MIM 605846
UniProt ID Q9BQE9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCL7B Products

Required fields are marked with *

My Review for All BCL7B Products

Required fields are marked with *

0
cart-icon
0
compare icon