Recombinant Human BCL7C Protein, GST-tagged

Cat.No. : BCL7C-167H
Product Overview : Human BCL7C partial ORF ( NP_004756, 86 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is identified by the similarity of its product to the N-terminal region of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. The function of this gene has not yet been determined. [provided by RefSeq]
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 34.43 kDa
AA Sequence : PLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPVSPAGPPEGVPEEAQPPRLGQERDPGGITAGSTDEPPMLT
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BCL7C B-cell CLL/lymphoma 7C [ Homo sapiens ]
Official Symbol BCL7C
Synonyms BCL7C; B-cell CLL/lymphoma 7C; B-cell CLL/lymphoma 7 protein family member C;
Gene ID 9274
mRNA Refseq NM_004765
Protein Refseq NP_004756
MIM 605847
UniProt ID Q8WUZ0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCL7C Products

Required fields are marked with *

My Review for All BCL7C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon