Recombinant Human BCL7C Protein, GST-tagged
Cat.No. : | BCL7C-167H |
Product Overview : | Human BCL7C partial ORF ( NP_004756, 86 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is identified by the similarity of its product to the N-terminal region of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. The function of this gene has not yet been determined. [provided by RefSeq] |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 34.43 kDa |
AA Sequence : | PLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPVSPAGPPEGVPEEAQPPRLGQERDPGGITAGSTDEPPMLT |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BCL7C B-cell CLL/lymphoma 7C [ Homo sapiens ] |
Official Symbol | BCL7C |
Synonyms | BCL7C; B-cell CLL/lymphoma 7C; B-cell CLL/lymphoma 7 protein family member C; |
Gene ID | 9274 |
mRNA Refseq | NM_004765 |
Protein Refseq | NP_004756 |
MIM | 605847 |
UniProt ID | Q8WUZ0 |
◆ Recombinant Proteins | ||
BCL7C-2446H | Recombinant human BCL7C, His-tagged | +Inquiry |
BCL7C-10189H | Recombinant Human BCL7C, GST-tagged | +Inquiry |
BCL7C-167H | Recombinant Human BCL7C Protein, GST-tagged | +Inquiry |
BCL7C-166H | Recombinant Human BCL7C Protein, GST-tagged | +Inquiry |
BCL7C-526R | Recombinant Rhesus monkey BCL7C Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCL7C-8476HCL | Recombinant Human BCL7C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCL7C Products
Required fields are marked with *
My Review for All BCL7C Products
Required fields are marked with *