Recombinant Human BCL7C Protein, GST-tagged

• Cat.No.: BCL7C-167H
• Product Overview: Human BCL7C partial ORF ( NP_004756, 86 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is identified by the similarity of its product to the N-terminal region of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. The function of this gene has not yet been determined. [provided by RefSeq]
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 34.43 kDa
• AA Sequence: PLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPVSPAGPPEGVPEEAQPPRLGQERDPGGITAGSTDEPPMLT
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BCL7C B-cell CLL/lymphoma 7C [ Homo sapiens ]
• Official Symbol: BCL7C
• Synonyms: BCL7C; B-cell CLL/lymphoma 7C; B-cell CLL/lymphoma 7 protein family member C
• Gene ID: 9274
• mRNA Refseq: NM_004765
• Protein Refseq: NP_004756
• MIM: 605847
• UniProt ID: Q8WUZ0