Recombinant Human BCL9L Protein, GST-tagged

• Cat.No.: BCL9L-169H
• Product Overview: Human BCL9L partial ORF ( NP_872363, 606 a.a. - 715 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.84 kDa
• AA Sequence: NQIQRVPGFGGMQSMPMEVPMNAMQRPVRPGMGWTEDLPPMGGPSNFAQNTMPYPGGQGEAERFMTPRVREELLRHQLLEKRSMGMQRPLGMAGSGMGQSMEMERMMQAH
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BCL9L B-cell CLL/lymphoma 9-like [ Homo sapiens ]
• Official Symbol: BCL9L
• Synonyms: BCL9L; B-cell CLL/lymphoma 9-like; B-cell CLL/lymphoma 9-like protein; DLNB11; protein BCL9-2; BCL9-like protein; B-cell lymphoma 9-like protein; nuclear co-factor of beta-catenin signalling; BCL9-2
• Gene ID: 283149
• mRNA Refseq: NM_182557
• Protein Refseq: NP_872363
• MIM: 609004
• UniProt ID: Q86UU0