Recombinant Human BCL9L Protein, GST-tagged

Cat.No. : BCL9L-169H
Product Overview : Human BCL9L partial ORF ( NP_872363, 606 a.a. - 715 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.84 kDa
AA Sequence : NQIQRVPGFGGMQSMPMEVPMNAMQRPVRPGMGWTEDLPPMGGPSNFAQNTMPYPGGQGEAERFMTPRVREELLRHQLLEKRSMGMQRPLGMAGSGMGQSMEMERMMQAH
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BCL9L B-cell CLL/lymphoma 9-like [ Homo sapiens ]
Official Symbol BCL9L
Synonyms BCL9L; B-cell CLL/lymphoma 9-like; B-cell CLL/lymphoma 9-like protein; DLNB11; protein BCL9-2; BCL9-like protein; B-cell lymphoma 9-like protein; nuclear co-factor of beta-catenin signalling; BCL9-2;
Gene ID 283149
mRNA Refseq NM_182557
Protein Refseq NP_872363
MIM 609004
UniProt ID Q86UU0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCL9L Products

Required fields are marked with *

My Review for All BCL9L Products

Required fields are marked with *

0
cart-icon