Recombinant Human BCL9L Protein, GST-tagged
Cat.No. : | BCL9L-169H |
Product Overview : | Human BCL9L partial ORF ( NP_872363, 606 a.a. - 715 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | NQIQRVPGFGGMQSMPMEVPMNAMQRPVRPGMGWTEDLPPMGGPSNFAQNTMPYPGGQGEAERFMTPRVREELLRHQLLEKRSMGMQRPLGMAGSGMGQSMEMERMMQAH |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BCL9L B-cell CLL/lymphoma 9-like [ Homo sapiens ] |
Official Symbol | BCL9L |
Synonyms | BCL9L; B-cell CLL/lymphoma 9-like; B-cell CLL/lymphoma 9-like protein; DLNB11; protein BCL9-2; BCL9-like protein; B-cell lymphoma 9-like protein; nuclear co-factor of beta-catenin signalling; BCL9-2; |
Gene ID | 283149 |
mRNA Refseq | NM_182557 |
Protein Refseq | NP_872363 |
MIM | 609004 |
UniProt ID | Q86UU0 |
◆ Recombinant Proteins | ||
BCL9L-1002M | Recombinant Mouse BCL9L Protein, His (Fc)-Avi-tagged | +Inquiry |
BCL9L-1419Z | Recombinant Zebrafish BCL9L | +Inquiry |
BCL9L-2357M | Recombinant Mouse BCL9L Protein | +Inquiry |
BCL9L-169H | Recombinant Human BCL9L Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCL9L Products
Required fields are marked with *
My Review for All BCL9L Products
Required fields are marked with *
0
Inquiry Basket