Recombinant Human BCORP1 Protein, GST-tagged

Cat.No. : BCORP1-176H
Product Overview : Human BCORL2 full-length ORF ( ENSP00000346742, 1 a.a. - 145 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 42.7 kDa
AA Sequence : MKEKLSKKRAEVKGNRSWLEEFLKPSDNEEGPPPKNKVLSNNASSQKPTHSSCIPLLRLPDKQQKVNESIKTDMLCTDKEEECPAASLLQKYTNNSEKPSGKRQCKTKHLISQDLRQGFLLTGKCYVENADGKIPLGTCFLLGLI
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BCORP1 BCL6 corepressor pseudogene 1 [ Homo sapiens (human) ]
Official Symbol BCORP1
Synonyms BCORL2;BCORP1
Gene ID 286554
UniProt ID Q8N888

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCORP1 Products

Required fields are marked with *

My Review for All BCORP1 Products

Required fields are marked with *

0
cart-icon