Recombinant Human BCORP1 Protein, GST-tagged
| Cat.No. : | BCORP1-176H |
| Product Overview : | Human BCORL2 full-length ORF ( ENSP00000346742, 1 a.a. - 145 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 42.7 kDa |
| AA Sequence : | MKEKLSKKRAEVKGNRSWLEEFLKPSDNEEGPPPKNKVLSNNASSQKPTHSSCIPLLRLPDKQQKVNESIKTDMLCTDKEEECPAASLLQKYTNNSEKPSGKRQCKTKHLISQDLRQGFLLTGKCYVENADGKIPLGTCFLLGLI |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BCORP1 BCL6 corepressor pseudogene 1 [ Homo sapiens (human) ] |
| Official Symbol | BCORP1 |
| Synonyms | BCORL2;BCORP1 |
| Gene ID | 286554 |
| UniProt ID | Q8N888 |
| ◆ Recombinant Proteins | ||
| BCORP1-176H | Recombinant Human BCORP1 Protein, GST-tagged | +Inquiry |
| BCORP1-4615H | Recombinant Human BCORP1 protein, His-tagged | +Inquiry |
| BCORP1-1558HF | Recombinant Full Length Human BCORP1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCORP1 Products
Required fields are marked with *
My Review for All BCORP1 Products
Required fields are marked with *
