Recombinant Human BDKRB2 Protein, GST-tagged
| Cat.No. : | BDKRB2-186H |
| Product Overview : | Human BDKRB2 partial ORF ( NP_000614, 1 a.a. - 60 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein. [provided by RefSeq] |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 32.34 kDa |
| AA Sequence : | MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BDKRB2 bradykinin receptor B2 [ Homo sapiens ] |
| Official Symbol | BDKRB2 |
| Synonyms | BDKRB2; bradykinin receptor B2; B2 bradykinin receptor; BK 2; BK-2 receptor; B2R; BK2; BK-2; BKR2; BRB2; DKFZp686O088; |
| Gene ID | 624 |
| mRNA Refseq | NM_000623 |
| Protein Refseq | NP_000614 |
| MIM | 113503 |
| UniProt ID | P30411 |
| ◆ Recombinant Proteins | ||
| RFL6459RF | Recombinant Full Length Rat B2 Bradykinin Receptor(Bdkrb2) Protein, His-Tagged | +Inquiry |
| BDKRB2-3197C | Recombinant Chicken BDKRB2 | +Inquiry |
| BDKRB2-2540H | Recombinant Human BDKRB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BDKRB2-89C | Recombinant Cynomolgus Monkey BDKRB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BDKRB2-185H | Recombinant Human BDKRB2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BDKRB2 Products
Required fields are marked with *
My Review for All BDKRB2 Products
Required fields are marked with *



