Recombinant Human BDKRB2 Protein, GST-tagged
Cat.No. : | BDKRB2-186H |
Product Overview : | Human BDKRB2 partial ORF ( NP_000614, 1 a.a. - 60 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein. [provided by RefSeq] |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 32.34 kDa |
AA Sequence : | MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BDKRB2 bradykinin receptor B2 [ Homo sapiens ] |
Official Symbol | BDKRB2 |
Synonyms | BDKRB2; bradykinin receptor B2; B2 bradykinin receptor; BK 2; BK-2 receptor; B2R; BK2; BK-2; BKR2; BRB2; DKFZp686O088; |
Gene ID | 624 |
mRNA Refseq | NM_000623 |
Protein Refseq | NP_000614 |
MIM | 113503 |
UniProt ID | P30411 |
◆ Recombinant Proteins | ||
BDKRB2-341C | Recombinant Cynomolgus BDKRB2 Protein, His-tagged | +Inquiry |
BDKRB2-1565HF | Recombinant Full Length Human BDKRB2 Protein, GST-tagged | +Inquiry |
BDKRB2-309H | Recombinant Human BDKRB2 Protein, His&GST-tagged | +Inquiry |
BDKRB2-186H | Recombinant Human BDKRB2 Protein, GST-tagged | +Inquiry |
BDKRB2-155H | Recombinant Human BDKRB2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BDKRB2 Products
Required fields are marked with *
My Review for All BDKRB2 Products
Required fields are marked with *
0
Inquiry Basket