Recombinant Human BDKRB2 Protein, GST-tagged

• Cat.No.: BDKRB2-186H
• Product Overview: Human BDKRB2 partial ORF ( NP_000614, 1 a.a. - 60 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein. [provided by RefSeq]
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 32.34 kDa
• AA Sequence: MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BDKRB2 bradykinin receptor B2 [ Homo sapiens ]
• Official Symbol: BDKRB2
• Synonyms: BDKRB2; bradykinin receptor B2; B2 bradykinin receptor; BK 2; BK-2 receptor; B2R; BK2; BK-2; BKR2; BRB2; DKFZp686O088
• Gene ID: 624
• mRNA Refseq: NM_000623
• Protein Refseq: NP_000614
• MIM: 113503
• UniProt ID: P30411