Recombinant Human BDKRB2 Protein, GST-tagged

Cat.No. : BDKRB2-186H
Product Overview : Human BDKRB2 partial ORF ( NP_000614, 1 a.a. - 60 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein. [provided by RefSeq]
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 32.34 kDa
AA Sequence : MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BDKRB2 bradykinin receptor B2 [ Homo sapiens ]
Official Symbol BDKRB2
Synonyms BDKRB2; bradykinin receptor B2; B2 bradykinin receptor; BK 2; BK-2 receptor; B2R; BK2; BK-2; BKR2; BRB2; DKFZp686O088;
Gene ID 624
mRNA Refseq NM_000623
Protein Refseq NP_000614
MIM 113503
UniProt ID P30411

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BDKRB2 Products

Required fields are marked with *

My Review for All BDKRB2 Products

Required fields are marked with *

0
cart-icon