Active Recombinant Human BDNF Protein
| Cat.No. : | BDNF-72H |
| Product Overview : | Active Recombinant Human BDNF Protein(P23560)(129-247 aa) was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | CHO |
| Tag : | Non |
| Protein Length : | 129-247 aa |
| Form : | Lyophilized from a 0.22 um filtered solution containing PBS,5% mannitol and 0.01% Tween 80, pH7.4 |
| Bio-activity : | The activity is determined by the dose-dependent proliferation of C6 cell sand is typically between 0.5-1.5 ug/mL. Corresponding to a specific Activity of 1 x 10^3 units/mg. |
| Molecular Mass : | 13.5 kDa |
| AASequence : | HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
| Endotoxin : | ≤10 EU/mg by the LAL method |
| Purity : | ≥95%, by SDS-PAGE (under conditions, visualized by Coomassie staining) |
| Storage : | 36 months at -20°C to -80°C in lyophilized state 6 months at -20°C to -80°C under sterile conditions after reconstitution 7-10 days at 2°C to 8°C under sterile conditions after reconstitution Use a manual defrost freezer and avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Publications : |
A Novel Brain Penetrable Nanocarrier Delivers Brain-Derived Neurotrophic Factor to Treat Alzheimer's Disease (2025)
|
| Gene Name | BDNF brain-derived neurotrophic factor [ Homo sapiens ] |
| Official Symbol | BDNF |
| Synonyms | BDNF; brain-derived neurotrophic factor; neurotrophin; abrineurin; MGC34632; |
| Gene ID | 627 |
| mRNA Refseq | NM_001143805 |
| Protein Refseq | NP_001137277 |
| MIM | 113505 |
| UniProt ID | P23560 |
| ◆ Recombinant Proteins | ||
| BDNF-231H | Recombinant Human Brain-derived Neurotrophic Factor, His-tagged | +Inquiry |
| Bdnf-310M | Recombinant Mouse Bdnf Protein, His-tagged | +Inquiry |
| BDNF-311C | Recombinant Cattle BDNF Protein, His-tagged | +Inquiry |
| Bdnf-703M | Recombinant Mouse Bdnf Protein, MYC/DDK-tagged | +Inquiry |
| BDNF-258H | Recombinant Human BDNF protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BDNF-001MCL | Recombinant Mouse BDNF cell lysate | +Inquiry |
| BDNF-072HKCL | Human BDNF Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BDNF Products
Required fields are marked with *
My Review for All BDNF Products
Required fields are marked with *
