Active Recombinant Human BDNF Protein

• Cat.No.: BDNF-72H
• Product Overview: Active Recombinant Human BDNF Protein(P23560)(129-247 aa) was expressed in CHO.

Specification

• Species: Human
• Source: CHO
• Tag: Non
• Protein Length: 129-247 aa
• Form: Lyophilized from a 0.22 um filtered solution containing PBS,5% mannitol and 0.01% Tween 80, pH7.4
• Bio-activity: The activity is determined by the dose-dependent proliferation of C6 cell sand is typically between 0.5-1.5 ug/mL. Corresponding to a specific Activity of 1 x 10^3 units/mg.
• Molecular Mass: 13.5 kDa
• AASequence: HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
• Endotoxin: ≤10 EU/mg by the LAL method
• Purity: ≥95%, by SDS-PAGE (under conditions, visualized by Coomassie staining)
• Storage: 36 months at -20°C to -80°C in lyophilized state 6 months at -20°C to -80°C under sterile conditions after reconstitution 7-10 days at 2°C to 8°C under sterile conditions after reconstitution Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: BDNF brain-derived neurotrophic factor [ Homo sapiens ]
• Official Symbol: BDNF
• Synonyms: BDNF; brain-derived neurotrophic factor; neurotrophin; abrineurin; MGC34632
• Gene ID: 627
• mRNA Refseq: NM_001143805
• Protein Refseq: NP_001137277
• MIM: 113505
• UniProt ID: P23560