Recombinant Human BDNF protein

Cat.No. : BDNF-258H
Product Overview : Recombinant Human BDNF, transcript variant 2, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : This gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene is reduced in Alzheimer's, Parkinson's, and Huntington's disease patients. This gene may play a role in the regulation of the stress response and in the biology of mood disorders.
Form : Lyophilized from a 0.2 µM filtered solution of 20mM PB, 250mM NaCl, pH 7.2
Molecular Mass : 52kD
AA Sequence : MAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name BDNF brain-derived neurotrophic factor [ Homo sapiens ]
Official Symbol BDNF
Synonyms BDNF; brain-derived neurotrophic factor; neurotrophin; abrineurin; MGC34632;
Gene ID 627
mRNA Refseq NM_001143805
Protein Refseq NP_733928
MIM 113505
UniProt ID P23560

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BDNF Products

Required fields are marked with *

My Review for All BDNF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon