Recombinant Human BDNF protein
Cat.No. : | BDNF-258H |
Product Overview : | Recombinant Human BDNF, transcript variant 2, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene is reduced in Alzheimer's, Parkinson's, and Huntington's disease patients. This gene may play a role in the regulation of the stress response and in the biology of mood disorders. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 250mM NaCl, pH 7.2 |
Molecular Mass : | 52kD |
AA Sequence : | MAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | BDNF brain-derived neurotrophic factor [ Homo sapiens ] |
Official Symbol | BDNF |
Synonyms | BDNF; brain-derived neurotrophic factor; neurotrophin; abrineurin; MGC34632; |
Gene ID | 627 |
mRNA Refseq | NM_001143805 |
Protein Refseq | NP_733928 |
MIM | 113505 |
UniProt ID | P23560 |
◆ Recombinant Proteins | ||
BDNF-2585H | Recombinant Human BDNF protein, His-SUMO-tagged | +Inquiry |
BDNF-551P | Recombinant Pig BDNF protein, His-tagged | +Inquiry |
BDNF-624R | Recombinant Rat BDNF Protein, His (Fc)-Avi-tagged | +Inquiry |
Bdnf-736M | Recombinant Mouse Bdnf protein | +Inquiry |
BDNF-4565H | Recombinant Human BDNF protein, For Organoid Culture | +Inquiry |
◆ Cell & Tissue Lysates | ||
BDNF-001MCL | Recombinant Mouse BDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BDNF Products
Required fields are marked with *
My Review for All BDNF Products
Required fields are marked with *
0
Inquiry Basket