Recombinant Human BDNF Protein, His-tagged
| Cat.No. : | BDNF-22H |
| Product Overview : | Recombinant Human BDNF Protein (Ala19–Arg128) was expressed in HEK293 cells with C-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 19-128 a.a. |
| Form : | Lyophilized (freeze-dried) powder |
| Molecular Mass : | 13.1 kDa |
| AA Sequence : | APMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHHHHHH |
| Endotoxin : | < 1.0 EU/µg |
| Purity : | > 95 % |
| Storage : | Store lyophilized protein at -80 centigrade. Lyophilized protein remains stable until the expiry date when stored at -80 centigrade. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 centigrade for long term storage. Reconstituted protein can be stored at 4 centigrade for a week. |
| Storage Buffer : | phosphate buffered saline. |
| Reconstitution : | Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. |
| Gene Name | BDNF brain-derived neurotrophic factor [ Homo sapiens ] |
| Official Symbol | BDNF |
| Synonyms | BDNF; brain-derived neurotrophic factor; neurotrophin; abrineurin; MGC34632; |
| Gene ID | 627 |
| mRNA Refseq | NM_001143805 |
| Protein Refseq | NP_001137277 |
| MIM | 113505 |
| UniProt ID | P23560 |
| ◆ Recombinant Proteins | ||
| BDNF-549H | Recombinant Human BDNF protein, GST-tagged | +Inquiry |
| Bdnf-548G | Recombinant Guinea pig Bdnf protein, His & GST-tagged | +Inquiry |
| BDNF-2585H | Recombinant Human BDNF protein, His-SUMO-tagged | +Inquiry |
| Bdnf-310M | Recombinant Mouse Bdnf Protein, His-tagged | +Inquiry |
| BDNF-243H | Active Recombinant Human BDNF protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BDNF-001MCL | Recombinant Mouse BDNF cell lysate | +Inquiry |
| BDNF-072HKCL | Human BDNF Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BDNF Products
Required fields are marked with *
My Review for All BDNF Products
Required fields are marked with *
