"BDNF" Related Products

Expand
Expand

Recombinant Human BDNF Protein, His-tagged

Cat.No.: BDNF-22H
Product Overview: Recombinant Human BDNF Protein (Ala19–Arg128) was expressed in HEK293 cells with C-terminal His tag.
Source: HEK293
Species: Human
Tag : His
Form: Lyophilized (freeze-dried) powder
Molecular Mass: 13.1 kDa
AA Sequence: APMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHHHHHH
Endotoxin: < 1.0 EU/µg
Purity: > 95 %
Storage: Store lyophilized protein at -80 centigrade. Lyophilized protein remains stable until the expiry date when stored at -80 centigrade. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 centigrade for long term storage. Reconstituted protein can be stored at 4 centigrade for a week.
Storage Buffer: phosphate buffered saline.
Reconstitution: Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely.
Gene Name: BDNF brain-derived neurotrophic factor [ Homo sapiens ]
Official Symbol: BDNF
Synonyms: BDNF; brain-derived neurotrophic factor; neurotrophin; abrineurin; MGC34632;
Gene ID: 627
mRNA Refseq: NM_001143805
Protein Refseq: NP_001137277
MIM: 113505
UniProt ID: P23560

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.