Recombinant Human BDNF Protein, His-tagged

Cat.No. : BDNF-22H
Product Overview : Recombinant Human BDNF Protein (Ala19–Arg128) was expressed in HEK293 cells with C-terminal His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 19-128 a.a.
Form : Lyophilized (freeze-dried) powder
Molecular Mass : 13.1 kDa
AA Sequence : APMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHHHHHH
Endotoxin : < 1.0 EU/µg
Purity : > 95 %
Storage : Store lyophilized protein at -80 centigrade. Lyophilized protein remains stable until the expiry date when stored at -80 centigrade. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 centigrade for long term storage. Reconstituted protein can be stored at 4 centigrade for a week.
Storage Buffer : phosphate buffered saline.
Reconstitution : Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely.
Gene Name BDNF brain-derived neurotrophic factor [ Homo sapiens ]
Official Symbol BDNF
Synonyms BDNF; brain-derived neurotrophic factor; neurotrophin; abrineurin; MGC34632;
Gene ID 627
mRNA Refseq NM_001143805
Protein Refseq NP_001137277
MIM 113505
UniProt ID P23560

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BDNF Products

Required fields are marked with *

My Review for All BDNF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon