"BDNF" Related Products

Expand
Expand

Recombinant Human BDNF Protein, His-tagged

Cat.No. : BDNF-22H
Product Overview : Recombinant Human BDNF Protein (Ala19–Arg128) was expressed in HEK293 cells with C-terminal His tag.
Source : HEK293
Species : Human
Tag : His
Form : Lyophilized (freeze-dried) powder
Molecular Mass : 13.1 kDa
AA Sequence : APMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHHHHHH
Endotoxin : < 1.0 EU/µg
Purity : > 95 %
Storage : Store lyophilized protein at -80 centigrade. Lyophilized protein remains stable until the expiry date when stored at -80 centigrade. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 centigrade for long term storage. Reconstituted protein can be stored at 4 centigrade for a week.
Storage Buffer : phosphate buffered saline.
Reconstitution : Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely.
Gene Name : BDNF brain-derived neurotrophic factor [ Homo sapiens ]
Official Symbol : BDNF
Synonyms : BDNF; brain-derived neurotrophic factor; neurotrophin; abrineurin; MGC34632;
Gene ID : 627
mRNA Refseq : NM_001143805
Protein Refseq : NP_001137277
MIM : 113505
UniProt ID : P23560

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.