Recombinant Human BECN1 Protein, GST-tagged
Cat.No. : | BECN1-190H |
Product Overview : | Human BECN1 partial ORF ( AAH10276, 351 a.a. - 450 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | LYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BECN1 beclin 1, autophagy related [ Homo sapiens ] |
Official Symbol | BECN1 |
Synonyms | BECN1; beclin 1, autophagy related; beclin 1 (coiled coil, moesin like BCL2 interacting protein); beclin-1; ATG6; ATG6 autophagy related 6 homolog (S. cerevisiae); VPS30; ATG6 autophagy related 6 homolog; coiled-coil myosin-like BCL2-interacting protein; |
Gene ID | 8678 |
mRNA Refseq | NM_003766 |
Protein Refseq | NP_003757 |
MIM | 604378 |
UniProt ID | Q14457 |
◆ Recombinant Proteins | ||
BECN1-190H | Recombinant Human BECN1 Protein, GST-tagged | +Inquiry |
BECN1-967R | Recombinant Rat BECN1 Protein | +Inquiry |
BECN1-161HFL | Active Recombinant Full Length Human BECN1 Protein, C-Flag-tagged | +Inquiry |
BECN1-189H | Recombinant Human BECN1 Protein, GST-tagged | +Inquiry |
BECN1-625R | Recombinant Rat BECN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BECN1-8470HCL | Recombinant Human BECN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BECN1 Products
Required fields are marked with *
My Review for All BECN1 Products
Required fields are marked with *
0
Inquiry Basket