Recombinant Human BECN1 Protein, GST-tagged
| Cat.No. : | BECN1-190H |
| Product Overview : | Human BECN1 partial ORF ( AAH10276, 351 a.a. - 450 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | LYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BECN1 beclin 1, autophagy related [ Homo sapiens ] |
| Official Symbol | BECN1 |
| Synonyms | BECN1; beclin 1, autophagy related; beclin 1 (coiled coil, moesin like BCL2 interacting protein); beclin-1; ATG6; ATG6 autophagy related 6 homolog (S. cerevisiae); VPS30; ATG6 autophagy related 6 homolog; coiled-coil myosin-like BCL2-interacting protein; |
| Gene ID | 8678 |
| mRNA Refseq | NM_003766 |
| Protein Refseq | NP_003757 |
| MIM | 604378 |
| UniProt ID | Q14457 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BECN1 Products
Required fields are marked with *
My Review for All BECN1 Products
Required fields are marked with *




