"BECN1" Related Products

Expand
Expand
Expand

Recombinant Human BECN1 Protein, GST-tagged

Cat.No.: BECN1-190H
Product Overview: Human BECN1 partial ORF ( AAH10276, 351 a.a. - 450 a.a.) recombinant protein with GST-tag at N-terminal.
Source: Wheat Germ
Species: Human
Tag : GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.63 kDa
AA Sequence: LYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: BECN1 beclin 1, autophagy related [ Homo sapiens ]
Official Symbol: BECN1
Synonyms: BECN1; beclin 1, autophagy related; beclin 1 (coiled coil, moesin like BCL2 interacting protein); beclin-1; ATG6; ATG6 autophagy related 6 homolog (S. cerevisiae); VPS30; ATG6 autophagy related 6 homolog; coiled-coil myosin-like BCL2-interacting protein;
Gene ID: 8678
mRNA Refseq: NM_003766
Protein Refseq: NP_003757
MIM: 604378
UniProt ID: Q14457

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.