Recombinant Human BEGAIN Protein, GST-tagged
Cat.No. : | BEGAIN-191H |
Product Overview : | Human BEGAIN full-length ORF ( NP_065887.1, 1 a.a. - 593 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 91.2 kDa |
AA Sequence : | MEKLSALQEQKGELRKRLSYTTHKLEKLETEFDSTRHYLEIELRRAQEELEKVTEKLRRIQSNYMALQRINQELEDKLYRMGQHYEEEKRALSHEIVALNSHLLEAKVTIDKLSEDNELYRKDCNLAAQLLQCSQTYGRVHKVSELPSDFQERVSLHMEKHGCSLPSPLCHPAYADSVPTCVIAKVLEKPDPASLSSRLSDASARDLAFCDGVEKPGPRPPYKGDIYCSDTALYCPEERRRDRRPSVDAPVTDVGFLRAQNSTDSAAEEEEEAEAAAFPAGFQHEAFPSYAGSLPTSSSYSSFSATSEEKEHAQASTLTASQQAIYLNSRDELFDRKPPATTYEGSPRFAKATAAVAAPLEAEVAPGFGRTMSPYPAETFRFPASPGPQQALMPPNLWSLRAKPGTARLPGEDMRGQWRPLSVEDIGAYSYPVSAAGRASPCSFSERYYGGAGGSPGKKADGRASPLYASYKADSFSEGDDLSQGHLAEPCFLRAGGDLSLSPGRSADPLPGYAPSEGGDGDRLGVQLCGTASSPEPEQGSRDSLEPSSMEASPEMHPAARLSPQQAFPRTGGSGLSRKDSLTKAQLYGTLLN |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BEGAIN brain enriched guanylate kinase associated [ Homo sapiens (human) ] |
Official Symbol | BEGAIN |
Synonyms | BEGAIN |
Gene ID | 57596 |
mRNA Refseq | NM_020836.2 |
Protein Refseq | NP_065887.1 |
UniProt ID | Q9BUH8.1 |
◆ Recombinant Proteins | ||
BEGAIN-191H | Recombinant Human BEGAIN Protein, GST-tagged | +Inquiry |
Begain-1856M | Recombinant Mouse Begain Protein, Myc/DDK-tagged | +Inquiry |
BEGAIN-1568HF | Recombinant Full Length Human BEGAIN Protein, GST-tagged | +Inquiry |
BEGAIN-626R | Recombinant Rat BEGAIN Protein, His (Fc)-Avi-tagged | +Inquiry |
BEGAIN-968R | Recombinant Rat BEGAIN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BEGAIN-8469HCL | Recombinant Human BEGAIN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BEGAIN Products
Required fields are marked with *
My Review for All BEGAIN Products
Required fields are marked with *
0
Inquiry Basket