Recombinant Human BEND5 Protein, GST-tagged
Cat.No. : | BEND5-193H |
Product Overview : | Human BEND5 full-length ORF ( AAH11804.1, 1 a.a. - 252 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 55.6 kDa |
AA Sequence : | MDSLEDAVVPRALYEELLRNYQQQQEEMRHLQQELERTRRQLVQQAKKLKEYGALVSEMKELRDLNRRLQDVLLLRLGSGPAIDLEKVKSECLEPEPELRSTFSEEANTSSYYPAPAPVMDKYILDNGKVHLGSGIWVDEEKWHQLQVTQGDSKYTKNLAVMIWGTDVLKNRSVTGVATKKKKDAVPKPPLSPHKLSIVRECLYDRIAQETVDETEIAQRLSKVNKYICEKIMDINKSCKNEERREAKYNLQ |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BEND5 BEN domain containing 5 [ Homo sapiens (human) ] |
Official Symbol | BEND5 |
Synonyms | BEN domain-containing protein 5; Bend5; BEND5_HUMAN; C1orf165; chromosome 1 open reading frame 165; FLJ11588; BEND5 |
Gene ID | 79656 |
mRNA Refseq | NM_024603.2 |
Protein Refseq | NP_078879.2 |
UniProt ID | Q7L4P6 |
◆ Recombinant Proteins | ||
BEND5-530R | Recombinant Rhesus monkey BEND5 Protein, His-tagged | +Inquiry |
Bend5-1403M | Recombinant Mouse Bend5 Protein, Myc/DDK-tagged | +Inquiry |
BEND5-193H | Recombinant Human BEND5 Protein, GST-tagged | +Inquiry |
BEND5-2461H | Recombinant Human BEND5 Protein, MYC/DDK-tagged | +Inquiry |
BEND5-1570HF | Recombinant Full Length Human BEND5 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BEND5-62HCL | Recombinant Human BEND5 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BEND5 Products
Required fields are marked with *
My Review for All BEND5 Products
Required fields are marked with *
0
Inquiry Basket