Recombinant Human BEX5 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : BEX5-3286H
Product Overview : BEX5 MS Standard C13 and N15-labeled recombinant protein (NP_001012996) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The mouse orthologous protein seems not to exist. Koo et al have described a sequence that they named Bex5, but it probably represents a pseudogene.
Molecular Mass : 12.6 kDa
AA Sequence : MENVPKENKVVEKAPVQNEAPALGGGEYQEPGGNVKGVWAPHAPGFGEDVPNRLVDNIDMIDGDGDDMERFMEEMRELRRKIRELQLRYSLRILIGDPPHHDHHDEFCLMPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name BEX5 brain expressed X-linked 5 [ Homo sapiens (human) ]
Official Symbol BEX5
Synonyms BEX5; brain expressed, X-linked 5; BEX family member 5, NGFRAP1 like 1, NGFRAP1L1; protein BEX5; NGFRAP1-like 1; BEX family member 5; NGFRAP1-like protein 1; brain-expressed X-linked protein 5; nerve growth factor receptor-associated protein 2; NGFRAP1L1; MGC104434; MGC126446;
Gene ID 340542
mRNA Refseq NM_001012978
Protein Refseq NP_001012996
MIM 300693
UniProt ID Q5H9J7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BEX5 Products

Required fields are marked with *

My Review for All BEX5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon