Recombinant Human BEX5 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | BEX5-3286H |
Product Overview : | BEX5 MS Standard C13 and N15-labeled recombinant protein (NP_001012996) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The mouse orthologous protein seems not to exist. Koo et al have described a sequence that they named Bex5, but it probably represents a pseudogene. |
Molecular Mass : | 12.6 kDa |
AA Sequence : | MENVPKENKVVEKAPVQNEAPALGGGEYQEPGGNVKGVWAPHAPGFGEDVPNRLVDNIDMIDGDGDDMERFMEEMRELRRKIRELQLRYSLRILIGDPPHHDHHDEFCLMPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | BEX5 brain expressed X-linked 5 [ Homo sapiens (human) ] |
Official Symbol | BEX5 |
Synonyms | BEX5; brain expressed, X-linked 5; BEX family member 5, NGFRAP1 like 1, NGFRAP1L1; protein BEX5; NGFRAP1-like 1; BEX family member 5; NGFRAP1-like protein 1; brain-expressed X-linked protein 5; nerve growth factor receptor-associated protein 2; NGFRAP1L1; MGC104434; MGC126446; |
Gene ID | 340542 |
mRNA Refseq | NM_001012978 |
Protein Refseq | NP_001012996 |
MIM | 300693 |
UniProt ID | Q5H9J7 |
◆ Recombinant Proteins | ||
BEX5-2594H | Recombinant Human BEX5 Protein, His-tagged | +Inquiry |
BEX5-3286H | Recombinant Human BEX5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BEX5-10215H | Recombinant Human BEX5, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BEX5-8462HCL | Recombinant Human BEX5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BEX5 Products
Required fields are marked with *
My Review for All BEX5 Products
Required fields are marked with *
0
Inquiry Basket