Recombinant Human BEX5 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: BEX5-3286H
• Product Overview: BEX5 MS Standard C13 and N15-labeled recombinant protein (NP_001012996) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The mouse orthologous protein seems not to exist. Koo et al have described a sequence that they named Bex5, but it probably represents a pseudogene.
• Molecular Mass: 12.6 kDa
• AA Sequence: MENVPKENKVVEKAPVQNEAPALGGGEYQEPGGNVKGVWAPHAPGFGEDVPNRLVDNIDMIDGDGDDMERFMEEMRELRRKIRELQLRYSLRILIGDPPHHDHHDEFCLMPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: BEX5 brain expressed X-linked 5 [ Homo sapiens (human) ]
• Official Symbol: BEX5
• Synonyms: BEX5; brain expressed, X-linked 5; BEX family member 5, NGFRAP1 like 1, NGFRAP1L1; protein BEX5; NGFRAP1-like 1; BEX family member 5; NGFRAP1-like protein 1; brain-expressed X-linked protein 5; nerve growth factor receptor-associated protein 2; NGFRAP1L1; MGC104434; MGC126446
• Gene ID: 340542
• mRNA Refseq: NM_001012978
• Protein Refseq: NP_001012996
• MIM: 300693
• UniProt ID: Q5H9J7