Recombinant Human BFAR Protein, GST-tagged
Cat.No. : | BFAR-200H |
Product Overview : | Human BFAR full-length ORF ( NP_057645.1, 1 a.a. - 450 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 79.1 kDa |
AA Sequence : | MEEPQKSYVNTMDLERDEPLKSTGPQISVSEFSCHCCYDILVNPTTLNCGHSFCRHCLALWWASSKKTECPECREKWEGFPKVSILLRDAIEKLFPDAIRLRFEDIQQNNDIVQSLAAFQKYGNDQIPLAPNTGRANQQMGGGFFSGVLTALTGVAVVLLVYHWSSRESEHDLLVHKAVAKWTAEEVVLWLEQLGPWASLYRERFLSERVNGRLLLTLTEEEFSKTPYTIENSSHRRAILMELERVKALGVKPPQNLWEYKAVNPGRSLFLLYALKSSPRLSLLYLYLFDYTDTFLPFIHTICPLQEDSSGEDIVTKLLDLKEPTWKQWREFLVKYSFLPYQLIAEFAWDWLEVHYWTSRFLIINAMLLSVLELFSFWRIWSRSELKTVPQRMWSHFWKVSTQGLFVAMFWPLIPQFVCNCLFYWALYFNPIINIDLVVKELRRLETQVL |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BFAR bifunctional apoptosis regulator [ Homo sapiens ] |
Official Symbol | BFAR |
Synonyms | BFAR; bifunctional apoptosis regulator; BAR; RNF47; RING finger protein 47; bifunctional apoptosis inhibitor; |
Gene ID | 51283 |
mRNA Refseq | NM_016561 |
Protein Refseq | NP_057645 |
UniProt ID | Q9NZS9 |
◆ Recombinant Proteins | ||
BFAR-535R | Recombinant Rhesus monkey BFAR Protein, His-tagged | +Inquiry |
BFAR-201H | Recombinant Human BFAR Protein, GST-tagged | +Inquiry |
BFAR-1616HF | Recombinant Full Length Human BFAR Protein, GST-tagged | +Inquiry |
BFAR-632R | Recombinant Rat BFAR Protein, His (Fc)-Avi-tagged | +Inquiry |
BFAR-974R | Recombinant Rat BFAR Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BFAR Products
Required fields are marked with *
My Review for All BFAR Products
Required fields are marked with *
0
Inquiry Basket