Recombinant Human BFAR Protein, GST-tagged
| Cat.No. : | BFAR-201H |
| Product Overview : | Human BFAR partial ORF ( AAH03054, 101 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | LRFEDIQQNNDIVQSLAAFQKYGNDQIPLAPNTGRANQQMGGGFFSGVLTALTGVAVVLLVYHWSSRESEHDLLVHKAVAKWTAEEVVLWLEQLGPWASL |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BFAR bifunctional apoptosis regulator [ Homo sapiens ] |
| Official Symbol | BFAR |
| Synonyms | BFAR; bifunctional apoptosis regulator; BAR; RNF47; RING finger protein 47; bifunctional apoptosis inhibitor; |
| Gene ID | 51283 |
| mRNA Refseq | NM_016561 |
| Protein Refseq | NP_057645 |
| UniProt ID | Q9NZS9 |
| ◆ Recombinant Proteins | ||
| BFAR-200H | Recombinant Human BFAR Protein, GST-tagged | +Inquiry |
| BFAR-535R | Recombinant Rhesus monkey BFAR Protein, His-tagged | +Inquiry |
| BFAR-201H | Recombinant Human BFAR Protein, GST-tagged | +Inquiry |
| RFL22194MF | Recombinant Full Length Mouse Bifunctional Apoptosis Regulator(Bfar) Protein, His-Tagged | +Inquiry |
| BFAR-363R | Recombinant Rhesus Macaque BFAR Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BFAR Products
Required fields are marked with *
My Review for All BFAR Products
Required fields are marked with *
