Recombinant Human BHLHE22 protein, His-tagged
Cat.No. : | BHLHE22-3611H |
Product Overview : | Recombinant Human BHLHE22 protein(1-225 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-225 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MERGMHLGAAAAGEDDLFLHKSLSASTSKRLEAAFRSTPPGMDLSLAPPPRERPASSSSSPLGCFEPADPEGAGLLLPPPGGGGGGSAGSGGGGGGGVGVPGLLVGSAGVGGDPSLSSLPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPRASPGAGGGGAKAAEGCSNAHLHGGASVPPGGLGGGGGGGSSSGSSGGGGGSGSGSGG |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | BHLHE22 basic helix-loop-helix family, member e22 [ Homo sapiens ] |
Official Symbol | BHLHE22 |
Synonyms | BHLHE22; basic helix-loop-helix family, member e22; basic helix loop helix domain containing, class B, 5 , BHLHB5, TNRC20, trinucleotide repeat containing 20; class E basic helix-loop-helix protein 22; Beta3; bHLHe22; CAGL85; trinucleotide repeat containing 20; class B basic helix-loop-helix protein 5; trinucleotide repeat-containing gene 20 protein; basic helix-loop-helix domain containing, class B, 5; BHLHB5; TNRC20; |
Gene ID | 27319 |
mRNA Refseq | NM_152414 |
Protein Refseq | NP_689627 |
MIM | 613483 |
UniProt ID | Q8NFJ8 |
◆ Recombinant Proteins | ||
BHLHE22-1028M | Recombinant Mouse BHLHE22 Protein, His (Fc)-Avi-tagged | +Inquiry |
BHLHE22-11192Z | Recombinant Zebrafish BHLHE22 | +Inquiry |
BHLHE22-3611H | Recombinant Human BHLHE22 protein, His-tagged | +Inquiry |
BHLHE22-1620HF | Recombinant Full Length Human BHLHE22 Protein, GST-tagged | +Inquiry |
BHLHE22-211H | Recombinant Human BHLHE22 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BHLHE22 Products
Required fields are marked with *
My Review for All BHLHE22 Products
Required fields are marked with *
0
Inquiry Basket