Recombinant Human BHLHE22 protein, His-tagged

Cat.No. : BHLHE22-3611H
Product Overview : Recombinant Human BHLHE22 protein(1-225 aa), fused to His tag, was expressed in E. coli.
Availability May 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-225 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MERGMHLGAAAAGEDDLFLHKSLSASTSKRLEAAFRSTPPGMDLSLAPPPRERPASSSSSPLGCFEPADPEGAGLLLPPPGGGGGGSAGSGGGGGGGVGVPGLLVGSAGVGGDPSLSSLPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPRASPGAGGGGAKAAEGCSNAHLHGGASVPPGGLGGGGGGGSSSGSSGGGGGSGSGSGG
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name BHLHE22 basic helix-loop-helix family, member e22 [ Homo sapiens ]
Official Symbol BHLHE22
Synonyms BHLHE22; basic helix-loop-helix family, member e22; basic helix loop helix domain containing, class B, 5 , BHLHB5, TNRC20, trinucleotide repeat containing 20; class E basic helix-loop-helix protein 22; Beta3; bHLHe22; CAGL85; trinucleotide repeat containing 20; class B basic helix-loop-helix protein 5; trinucleotide repeat-containing gene 20 protein; basic helix-loop-helix domain containing, class B, 5; BHLHB5; TNRC20;
Gene ID 27319
mRNA Refseq NM_152414
Protein Refseq NP_689627
MIM 613483
UniProt ID Q8NFJ8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BHLHE22 Products

Required fields are marked with *

My Review for All BHLHE22 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon