Recombinant Human BHLHE22 protein, His-tagged

• Cat.No.: BHLHE22-3611H
• Product Overview: Recombinant Human BHLHE22 protein(1-225 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-225 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: MERGMHLGAAAAGEDDLFLHKSLSASTSKRLEAAFRSTPPGMDLSLAPPPRERPASSSSSPLGCFEPADPEGAGLLLPPPGGGGGGSAGSGGGGGGGVGVPGLLVGSAGVGGDPSLSSLPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPRASPGAGGGGAKAAEGCSNAHLHGGASVPPGGLGGGGGGGSSSGSSGGGGGSGSGSGG
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: BHLHE22 basic helix-loop-helix family, member e22 [ Homo sapiens ]
• Official Symbol: BHLHE22
• Synonyms: BHLHE22; basic helix-loop-helix family, member e22; basic helix loop helix domain containing, class B, 5 , BHLHB5, TNRC20, trinucleotide repeat containing 20; class E basic helix-loop-helix protein 22; Beta3; bHLHe22; CAGL85; trinucleotide repeat containing 20; class B basic helix-loop-helix protein 5; trinucleotide repeat-containing gene 20 protein; basic helix-loop-helix domain containing, class B, 5; BHLHB5; TNRC20
• Gene ID: 27319
• mRNA Refseq: NM_152414
• Protein Refseq: NP_689627
• MIM: 613483
• UniProt ID: Q8NFJ8