Recombinant Human BHLHE22 protein, His-tagged
| Cat.No. : | BHLHE22-3611H |
| Product Overview : | Recombinant Human BHLHE22 protein(1-225 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | November 30, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-225 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MERGMHLGAAAAGEDDLFLHKSLSASTSKRLEAAFRSTPPGMDLSLAPPPRERPASSSSSPLGCFEPADPEGAGLLLPPPGGGGGGSAGSGGGGGGGVGVPGLLVGSAGVGGDPSLSSLPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPRASPGAGGGGAKAAEGCSNAHLHGGASVPPGGLGGGGGGGSSSGSSGGGGGSGSGSGG |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | BHLHE22 basic helix-loop-helix family, member e22 [ Homo sapiens ] |
| Official Symbol | BHLHE22 |
| Synonyms | BHLHE22; basic helix-loop-helix family, member e22; basic helix loop helix domain containing, class B, 5 , BHLHB5, TNRC20, trinucleotide repeat containing 20; class E basic helix-loop-helix protein 22; Beta3; bHLHe22; CAGL85; trinucleotide repeat containing 20; class B basic helix-loop-helix protein 5; trinucleotide repeat-containing gene 20 protein; basic helix-loop-helix domain containing, class B, 5; BHLHB5; TNRC20; |
| Gene ID | 27319 |
| mRNA Refseq | NM_152414 |
| Protein Refseq | NP_689627 |
| MIM | 613483 |
| UniProt ID | Q8NFJ8 |
| ◆ Recombinant Proteins | ||
| BHLHE22-211H | Recombinant Human BHLHE22 Protein, GST-tagged | +Inquiry |
| BHLHE22-1028M | Recombinant Mouse BHLHE22 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BHLHE22-1620HF | Recombinant Full Length Human BHLHE22 Protein, GST-tagged | +Inquiry |
| BHLHE22-11192Z | Recombinant Zebrafish BHLHE22 | +Inquiry |
| BHLHE22-2396M | Recombinant Mouse BHLHE22 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BHLHE22 Products
Required fields are marked with *
My Review for All BHLHE22 Products
Required fields are marked with *
