Recombinant Human BHLHE23 protein, His-tagged
| Cat.No. : | BHLHE23-3666H |
| Product Overview : | Recombinant Human BHLHE23 protein(173-226 aa), fused to His tag, was expressed in E. coli. |
| Availability | July 28, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 173-226 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | GLAAPVNAAPLTPFGQATVCPFSAGAALGPCPDKCAAFSGTPSALCKHCHEKP |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | BHLHE23 basic helix-loop-helix family, member e23 [ Homo sapiens ] |
| Official Symbol | BHLHE23 |
| Synonyms | BHLHE23; basic helix-loop-helix family, member e23; basic helix loop helix domain containing, class B, 4 , BHLHB4; class E basic helix-loop-helix protein 23; bA305P22.3; Beta4; bHLHe23; class B basic helix-loop-helix protein 4; basic helix-loop-helix domain containing, class B, 4; BETA4; BHLHB4; |
| Gene ID | 128408 |
| mRNA Refseq | NM_080606 |
| Protein Refseq | NP_542173 |
| MIM | 609331 |
| UniProt ID | Q8NDY6 |
| ◆ Recombinant Proteins | ||
| BHLHE23-301245H | Recombinant Human BHLHE23 protein, GST-tagged | +Inquiry |
| BHLHE23-3666H | Recombinant Human BHLHE23 protein, His-tagged | +Inquiry |
| BHLHE23-2600H | Recombinant Human BHLHE23 Protein, MYC/DDK-tagged | +Inquiry |
| Bhlhe23-988M | Recombinant Mouse Bhlhe23 Protein, MYC/DDK-tagged | +Inquiry |
| BHLHE23-6073C | Recombinant Chicken BHLHE23 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BHLHE23 Products
Required fields are marked with *
My Review for All BHLHE23 Products
Required fields are marked with *



