Recombinant Human BHLHE23 protein, His-tagged

Cat.No. : BHLHE23-3666H
Product Overview : Recombinant Human BHLHE23 protein(173-226 aa), fused to His tag, was expressed in E. coli.
Availability May 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 173-226 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : GLAAPVNAAPLTPFGQATVCPFSAGAALGPCPDKCAAFSGTPSALCKHCHEKP
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name BHLHE23 basic helix-loop-helix family, member e23 [ Homo sapiens ]
Official Symbol BHLHE23
Synonyms BHLHE23; basic helix-loop-helix family, member e23; basic helix loop helix domain containing, class B, 4 , BHLHB4; class E basic helix-loop-helix protein 23; bA305P22.3; Beta4; bHLHe23; class B basic helix-loop-helix protein 4; basic helix-loop-helix domain containing, class B, 4; BETA4; BHLHB4;
Gene ID 128408
mRNA Refseq NM_080606
Protein Refseq NP_542173
MIM 609331
UniProt ID Q8NDY6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BHLHE23 Products

Required fields are marked with *

My Review for All BHLHE23 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon