Recombinant Human BHLHE40 Protein, GST-tagged
Cat.No. : | BHLHE40-212H |
Product Overview : | Human BHLHE40 full-length ORF ( ABZ92197.1, 1 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a basic helix-loop-helix protein expressed in various tissues. Expression in the chondrocytes is responsive to the addition of Bt2cAMP. The encoded protein is believed to be involved in the control of cell differentiation. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 45.4 kDa |
AA Sequence : | MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIALQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTDTDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGHFTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAAALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BHLHE40 basic helix-loop-helix family, member e40 [ Homo sapiens ] |
Official Symbol | BHLHE40 |
Synonyms | BHLHE40; basic helix-loop-helix family, member e40; basic helix loop helix domain containing, class B, 2 , BHLHB2, STRA13; class E basic helix-loop-helix protein 40; differentiated embryo chondrocyte expressed gene 1; bHLHe40; DEC1; differentially express |
Gene ID | 8553 |
mRNA Refseq | NM_003670 |
Protein Refseq | NP_003661 |
MIM | 604256 |
UniProt ID | O14503 |
◆ Recombinant Proteins | ||
Bhlhe40-1864M | Recombinant Mouse Bhlhe40 Protein, Myc/DDK-tagged | +Inquiry |
BHLHE40-044H | Recombinant Human basic helix-loop-helix family, member e40 Protein, His&StrepII tagged | +Inquiry |
BHLHE40-207H | Recombinant Human BHLHE40 Protein, GST-tagged | +Inquiry |
BHLHE40-04H | Recombinant Human BHLHE40 Protein, Myc/DDK-tagged | +Inquiry |
BHLHE40-1029M | Recombinant Mouse BHLHE40 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BHLHE40-8459HCL | Recombinant Human BHLHE40 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BHLHE40 Products
Required fields are marked with *
My Review for All BHLHE40 Products
Required fields are marked with *
0
Inquiry Basket