Recombinant Human BICD1 Protein, GST-tagged
Cat.No. : | BICD1-217H |
Product Overview : | Human BICD1 partial ORF ( NP_001705, 1 a.a. - 70 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is one of two human homologs of Drosophila bicaudal-D. It has been implicated in COPI-independent membrane transport from the Golgi apparatus to the endoplasmic reticulum. Two alternative splice variants have been described. Other alternative splice variants that encode different protein isoforms have been described but their full-length nature has not been determined. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 33.44 kDa |
AA Sequence : | MAAEEVLQTVDHYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYDSLKQELEQLK |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BICD1 bicaudal D homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | BICD1 |
Synonyms | Bic-D 1; Bicaudal D homolog 1; BICD; Bicd1; BICD1_HUMAN; Cytoskeleton like bicaudal D protein homolog 1; Protein bicaudal D homolog 1; BICD1 |
Gene ID | 636 |
mRNA Refseq | NM_001714.2 |
Protein Refseq | NP_001705.2 |
MIM | 602204 |
UniProt ID | Q96G01 |
◆ Recombinant Proteins | ||
BICD1-10225H | Recombinant Human BICD1 protein, GST-tagged | +Inquiry |
BICD1-2590H | Recombinant Human BICD1 Protein, MYC/DDK-tagged | +Inquiry |
BICD1-217H | Recombinant Human BICD1 Protein, GST-tagged | +Inquiry |
BICD1-2280H | Recombinant Human BICD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Bicd1-710M | Recombinant Mouse Bicd1 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BICD1 Products
Required fields are marked with *
My Review for All BICD1 Products
Required fields are marked with *