Recombinant Human BICD1 Protein, GST-tagged

Cat.No. : BICD1-217H
Product Overview : Human BICD1 partial ORF ( NP_001705, 1 a.a. - 70 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is one of two human homologs of Drosophila bicaudal-D. It has been implicated in COPI-independent membrane transport from the Golgi apparatus to the endoplasmic reticulum. Two alternative splice variants have been described. Other alternative splice variants that encode different protein isoforms have been described but their full-length nature has not been determined.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 33.44 kDa
AA Sequence : MAAEEVLQTVDHYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYDSLKQELEQLK
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BICD1 bicaudal D homolog 1 (Drosophila) [ Homo sapiens ]
Official Symbol BICD1
Synonyms Bic-D 1; Bicaudal D homolog 1; BICD; Bicd1; BICD1_HUMAN; Cytoskeleton like bicaudal D protein homolog 1; Protein bicaudal D homolog 1; BICD1
Gene ID 636
mRNA Refseq NM_001714.2
Protein Refseq NP_001705.2
MIM 602204
UniProt ID Q96G01

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BICD1 Products

Required fields are marked with *

My Review for All BICD1 Products

Required fields are marked with *

0
cart-icon