Recombinant Human BID protein, GST-tagged
Cat.No. : | BID-6444H |
Product Overview : | Recombinant Human BID protein(1-195 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-195 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | BID BH3 interacting domain death agonist [ Homo sapiens ] |
Official Symbol | BID |
Synonyms | BID; BH3 interacting domain death agonist; BH3-interacting domain death agonist; p22 BID; BID isoform Si6; BID isoform L(2); BID isoform ES(1b); desmocollin type 4; apoptic death agonist; Human BID coding sequence; FP497; MGC15319; MGC42355; |
Gene ID | 637 |
mRNA Refseq | NM_001196 |
Protein Refseq | NP_001187 |
MIM | 601997 |
UniProt ID | P55957 |
◆ Recombinant Proteins | ||
BID-6977H | Recombinant Human BID, GST-tagged | +Inquiry |
BID-26710TH | Recombinant Human BID | +Inquiry |
BID-6444H | Recombinant Human BID protein, GST-tagged | +Inquiry |
BID-2006H | Recombinant Human BID Protein, His-tagged | +Inquiry |
Bid-633R | Recombinant Rat Bid protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BID-8456HCL | Recombinant Human BID 293 Cell Lysate | +Inquiry |
BID-8455HCL | Recombinant Human BID 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BID Products
Required fields are marked with *
My Review for All BID Products
Required fields are marked with *
0
Inquiry Basket