Recombinant Human BID Protein, GST-tagged
Cat.No. : | BID-218H |
Product Overview : | Human BID full-length ORF ( AAH09197, 1 a.a. - 195 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a death agonist that heterodimerizes with either agonist BAX or antagonist BCL2. The encoded protein is a member of the BCL-2 family of cell death regulators. It is a mediator of mitochondrial damage induced by caspase-8 (CASP8); CASP8 cleaves this encoded protein, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release. Multiple alternatively spliced transcript variants have been found, but the full-length nature of some variants has not been defined. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 47.19 kDa |
AA Sequence : | MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BID BH3 interacting domain death agonist [ Homo sapiens ] |
Official Symbol | BID |
Synonyms | BID; BH3 interacting domain death agonist; BH3-interacting domain death agonist; p22 BID; BID isoform Si6; BID isoform L(2); BID isoform ES(1b); desmocollin type 4; apoptic death agonist; Human BID coding sequence; FP497; MGC15319; MGC42355; |
Gene ID | 637 |
mRNA Refseq | NM_001196 |
Protein Refseq | NP_001187 |
MIM | 601997 |
UniProt ID | P55957 |
◆ Recombinant Proteins | ||
BID-1339H | Recombinant Human BID Protein (Met1-Asp195), N-His tagged | +Inquiry |
BID-1625H | Recombinant Human BID Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BID-2006H | Recombinant Human BID Protein, His-tagged | +Inquiry |
Bid-711M | Recombinant Mouse Bid Protein, MYC/DDK-tagged | +Inquiry |
BID-2573H | Active Recombinant Human BID protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BID-8456HCL | Recombinant Human BID 293 Cell Lysate | +Inquiry |
BID-8455HCL | Recombinant Human BID 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BID Products
Required fields are marked with *
My Review for All BID Products
Required fields are marked with *