Recombinant Human BID Protein, GST-tagged

• Cat.No.: BID-218H
• Product Overview: Human BID full-length ORF ( AAH09197, 1 a.a. - 195 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a death agonist that heterodimerizes with either agonist BAX or antagonist BCL2. The encoded protein is a member of the BCL-2 family of cell death regulators. It is a mediator of mitochondrial damage induced by caspase-8 (CASP8); CASP8 cleaves this encoded protein, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release. Multiple alternatively spliced transcript variants have been found, but the full-length nature of some variants has not been defined.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 47.19 kDa
• AA Sequence: MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BID BH3 interacting domain death agonist [ Homo sapiens ]
• Official Symbol: BID
• Synonyms: BID; BH3 interacting domain death agonist; BH3-interacting domain death agonist; p22 BID; BID isoform Si6; BID isoform L(2); BID isoform ES(1b); desmocollin type 4; apoptic death agonist; Human BID coding sequence; FP497; MGC15319; MGC42355
• Gene ID: 637
• mRNA Refseq: NM_001196
• Protein Refseq: NP_001187
• MIM: 601997
• UniProt ID: P55957