Recombinant Human BID protein, His-SUMO-tagged
Cat.No. : | BID-2592H |
Product Overview : | Recombinant Human BID protein(P55957)(1-195aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-195aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38 kDa |
AA Sequence : | MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | BID BH3 interacting domain death agonist [ Homo sapiens ] |
Official Symbol | BID |
Synonyms | BID; BH3 interacting domain death agonist; BH3-interacting domain death agonist; p22 BID; BID isoform Si6; BID isoform L(2); BID isoform ES(1b); desmocollin type 4; apoptic death agonist; Human BID coding sequence; FP497; MGC15319; MGC42355; |
Gene ID | 637 |
mRNA Refseq | NM_001196 |
Protein Refseq | NP_001187 |
MIM | 601997 |
UniProt ID | P55957 |
◆ Recombinant Proteins | ||
BID-1625H | Recombinant Human BID Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Bid-1384M | Recombinant Mouse BH3 Interacting Domain Death Agonist, 61-195aa | +Inquiry |
BID-218H | Recombinant Human BID Protein, GST-tagged | +Inquiry |
BID-2006H | Recombinant Human BID Protein, His-tagged | +Inquiry |
BID-2404M | Recombinant Mouse BID Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BID-8456HCL | Recombinant Human BID 293 Cell Lysate | +Inquiry |
BID-8455HCL | Recombinant Human BID 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BID Products
Required fields are marked with *
My Review for All BID Products
Required fields are marked with *
0
Inquiry Basket