Recombinant Human BID Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | BID-1625H |
Product Overview : | BID MS Standard C13 and N15-labeled recombinant protein (NP_001187) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a death agonist that heterodimerizes with either agonist BAX or antagonist BCL2, and thus regulate apoptosis. The encoded protein is a member of the BCL-2 family of cell death regulators. It is a mediator of mitochondrial damage induced by caspase-8 (CASP8); CASP8 cleaves this encoded protein, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release. Multiple alternatively spliced transcript variants have been found, but the full-length nature of some variants has not been defined. |
Molecular Mass : | 26.8 kDa |
AA Sequence : | MCSGAGVMMARWAARGRAGWRSTVRILSPLGHCEPGVSRSCRAAQAMDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASQTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | BID BH3 interacting domain death agonist [ Homo sapiens (human) ] |
Official Symbol | BID |
Synonyms | BID; BH3 interacting domain death agonist; BH3-interacting domain death agonist; p22 BID; BID isoform Si6; BID isoform L(2); BID isoform ES(1b); desmocollin type 4; apoptic death agonist; Human BID coding sequence; FP497; MGC15319; MGC42355; |
Gene ID | 637 |
mRNA Refseq | NM_001196 |
Protein Refseq | NP_001187 |
MIM | 601997 |
UniProt ID | P55957 |
◆ Recombinant Proteins | ||
Bid-258M | Active Recombinant Mouse Bid | +Inquiry |
BID-6977H | Recombinant Human BID, GST-tagged | +Inquiry |
BID-1625HF | Recombinant Full Length Human BID Protein, GST-tagged | +Inquiry |
BID-218H | Recombinant Human BID Protein, GST-tagged | +Inquiry |
BID-2427H | Recombinant Human BH3 Interacting Domain Death Agonist, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BID-8456HCL | Recombinant Human BID 293 Cell Lysate | +Inquiry |
BID-8455HCL | Recombinant Human BID 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BID Products
Required fields are marked with *
My Review for All BID Products
Required fields are marked with *