Recombinant Human BIN1 Protein, GST-tagged
Cat.No. : | BIN1-222H |
Product Overview : | Human BIN1 partial ORF ( NP_004296, 355 a.a. - 454 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes several isoforms of a nucleocytoplasmic adaptor protein, one of which was initially identified as a MYC-interacting protein with features of a tumor suppressor. Isoforms that are expressed in the central nervous system may be involved in synaptic vesicle endocytosis and may interact with dynanim, synaptojanin, endophilin, and clathrin. Isoforms that are expressed in muscle and ubiquitously expressed isoforms localize to the cytoplasm and nucleus and activate a caspase-independent apoptotic process. Studies in mouse suggest that this gene plays an important role in cardiac muscle development. Alternate splicing of the gene results in ten transcript variants encoding different isoforms. Aberrant splice variants expressed in tumor cell lines have also been described. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | VVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BIN1 bridging integrator 1 [ Homo sapiens ] |
Official Symbol | BIN1 |
Synonyms | BIN1; bridging integrator 1; AMPHL; myc box-dependent-interacting protein 1; AMPH2; amphiphysin II; SH3P9; amphiphysin-like protein; box dependant MYC interacting protein 1; box-dependent myc-interacting protein 1; MGC10367; DKFZp547F068; |
Gene ID | 274 |
mRNA Refseq | NM_004305 |
Protein Refseq | NP_004296 |
MIM | 601248 |
UniProt ID | O00499 |
◆ Recombinant Proteins | ||
BIN1-16H | Recombinant Human BIN1 Protein, MYC/DDK-tagged | +Inquiry |
BIN1-10230H | Recombinant Human BIN1 protein, GST-tagged | +Inquiry |
BIN1-5167H | Recombinant Human BIN1 protein, His-tagged | +Inquiry |
BIN1-26751TH | Recombinant Human BIN1, His-tagged | +Inquiry |
BIN1-641R | Recombinant Rat BIN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BIN1-8454HCL | Recombinant Human BIN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BIN1 Products
Required fields are marked with *
My Review for All BIN1 Products
Required fields are marked with *
0
Inquiry Basket