"BIN1" Related Products

Expand
Expand

Recombinant Human BIN1 protein, His-tagged

Cat.No.: BIN1-192H
Product Overview: Recombinant human BIN1 ( 408 aa, Isoform-10 ) fused with a human Alpha-Fetal Protein N-terminal domain (AFPn)-His-TEV cleavage site at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: His
Form: 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPA FLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSGGSHHHHHHGSENLYFQGEFAEMGSK GVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKL NECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHY ESLQTAKKKDEAKIAKAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNL NDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQSSLP AVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGV KESDWNQHKELEKCRGVFPENFTERVP
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: BIN1 bridging integrator 1 [ Homo sapiens ]
Official Symbol: BIN1
Synonyms: BIN1; bridging integrator 1; AMPHL; myc box-dependent-interacting protein 1; AMPH2; amphiphysin II; SH3P9; amphiphysin-like protein; box dependant MYC interacting protein 1; box-dependent myc-interacting protein 1; MGC10367; DKFZp547F068;
Gene ID: 274
mRNA Refseq: NM_004305
Protein Refseq: NP_004296
MIM: 601248
UniProt ID: O00499
Chromosome Location: 2q14
Pathway: Arf6 trafficking events, organism-specific biosystem;
Function: GTPase binding; protein binding; protein heterodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.