Recombinant Human BIN1 protein, His-tagged
Cat.No. : | BIN1-192H |
Product Overview : | Recombinant human BIN1 ( 408 aa, Isoform-10 ) fused with a human Alpha-Fetal Protein N-terminal domain (AFPn)-His-TEV cleavage site at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 408 a.a. |
Form : | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPA FLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSGGSHHHHHHGSENLYFQGEFAEMGSK GVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKL NECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHY ESLQTAKKKDEAKIAKAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNL NDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQSSLP AVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGV KESDWNQHKELEKCRGVFPENFTERVP |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | BIN1 bridging integrator 1 [ Homo sapiens ] |
Official Symbol | BIN1 |
Synonyms | BIN1; bridging integrator 1; AMPHL; myc box-dependent-interacting protein 1; AMPH2; amphiphysin II; SH3P9; amphiphysin-like protein; box dependant MYC interacting protein 1; box-dependent myc-interacting protein 1; MGC10367; DKFZp547F068; |
Gene ID | 274 |
mRNA Refseq | NM_004305 |
Protein Refseq | NP_004296 |
MIM | 601248 |
UniProt ID | O00499 |
Chromosome Location | 2q14 |
Pathway | Arf6 trafficking events, organism-specific biosystem; |
Function | GTPase binding; protein binding; protein heterodimerization activity; |
◆ Recombinant Proteins | ||
BIN1-641R | Recombinant Rat BIN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BIN1-26316TH | Recombinant Human BIN1, His-tagged | +Inquiry |
BIN1-983R | Recombinant Rat BIN1 Protein | +Inquiry |
BIN1-2754H | Recombinant Human Bridging Integrator 1, His-tagged | +Inquiry |
BIN1-192H | Recombinant Human BIN1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BIN1-8454HCL | Recombinant Human BIN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BIN1 Products
Required fields are marked with *
My Review for All BIN1 Products
Required fields are marked with *