Recombinant Human BIRC5 protein(41-130 aa), N-mSUMO & C-His-tagged
Cat.No. : | BIRC5-2465H |
Product Overview : | Recombinant Human BIRC5 protein(O15392)(41-130 aa), fused with N-terminal mSUMO tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 41-130 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | AGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKK |
Gene Name | BIRC5 baculoviral IAP repeat containing 5 [ Homo sapiens ] |
Official Symbol | BIRC5 |
Synonyms | BIRC5; baculoviral IAP repeat containing 5; API4, apoptosis inhibitor 4 , baculoviral IAP repeat containing 5; baculoviral IAP repeat-containing protein 5; EPR 1; survivin; survivin variant 3 alpha; apoptosis inhibitor 4; apoptosis inhibitor survivin; API4; EPR-1; |
Gene ID | 332 |
mRNA Refseq | NM_001012270 |
Protein Refseq | NP_001012270 |
MIM | 603352 |
UniProt ID | O15392 |
◆ Recombinant Proteins | ||
BIRC5-5592H | Recombinant Human BIRC5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BIRC5-018HFL | Recombinant Full Length Human BIRC5 Protein, His&TEV tagged | +Inquiry |
BIRC5-541R | Recombinant Rhesus monkey BIRC5 Protein, His-tagged | +Inquiry |
BIRC5-1891C | Recombinant Chicken BIRC5 | +Inquiry |
BIRC5-229H | Recombinant Human BIRC5 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BIRC5-8449HCL | Recombinant Human BIRC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BIRC5 Products
Required fields are marked with *
My Review for All BIRC5 Products
Required fields are marked with *