Recombinant Human BIRC5 Protein, His-tagged

• Cat.No.: BIRC5-18H
• Product Overview: Recombinant Human BIRC5 Protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-142 aa
• Description: This gene is a member of the inhibitor of apoptosis (IAP) gene family, which encode negative regulatory proteins that prevent apoptotic cell death. IAP family members usually contain multiple baculovirus IAP repeat (BIR) domains, but this gene encodes proteins with only a single BIR domain. The encoded proteins also lack a C-terminus RING finger domain. Gene expression is high during fetal development and in most tumors, yet low in adult tissues. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Form: 50mM Tris, 500mM NaCl, 2mM DTT, pH 8.0.
• Molecular Mass: 18.55 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKKVRRAIEQLAAMD
• Purity: ＞90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.32mg/mL

Gene Information

• Gene Name: BIRC5 baculoviral IAP repeat containing 5 [ Homo sapiens (human) ]
• Official Symbol: BIRC5
• Synonyms: API4; EPR-1
• Gene ID: 332
• mRNA Refseq: NM_001168
• Protein Refseq: NP_001159
• MIM: 603352
• UniProt ID: O15392