Recombinant Human BIRC5 Protein, His-tagged
Cat.No. : | BIRC5-18H |
Product Overview : | Recombinant Human BIRC5 Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-142 aa |
Description : | This gene is a member of the inhibitor of apoptosis (IAP) gene family, which encode negative regulatory proteins that prevent apoptotic cell death. IAP family members usually contain multiple baculovirus IAP repeat (BIR) domains, but this gene encodes proteins with only a single BIR domain. The encoded proteins also lack a C-terminus RING finger domain. Gene expression is high during fetal development and in most tumors, yet low in adult tissues. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Form : | 50mM Tris, 500mM NaCl, 2mM DTT, pH 8.0. |
Molecular Mass : | 18.55 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKKVRRAIEQLAAMD |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.32mg/mL |
Gene Name | BIRC5 baculoviral IAP repeat containing 5 [ Homo sapiens (human) ] |
Official Symbol | BIRC5 |
Synonyms | API4; EPR-1 |
Gene ID | 332 |
mRNA Refseq | NM_001168 |
Protein Refseq | NP_001159 |
MIM | 603352 |
UniProt ID | O15392 |
◆ Recombinant Proteins | ||
BIRC5-0718H | Recombinant Human BIRC5 Protein (M1-D142), Tag Free | +Inquiry |
BIRC5-986R | Recombinant Rat BIRC5 Protein | +Inquiry |
BIRC5-7313HFL | Recombinant Full Length Human BIRC5 protein, Flag-tagged | +Inquiry |
BIRC5-369R | Recombinant Rhesus Macaque BIRC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
BIRC5-047H | Recombinant Human BIRC5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BIRC5-8449HCL | Recombinant Human BIRC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BIRC5 Products
Required fields are marked with *
My Review for All BIRC5 Products
Required fields are marked with *