Recombinant Human BIRC7 Protein, GST-tagged

Cat.No. : BIRC7-232H
Product Overview : Human BIRC7 partial ORF ( NP_647478.1, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the family of inhibitor of apoptosis proteins (IAP) and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING-type zinc finger domain. The BIR domain is essential for inhibitory activity and interacts with caspases, while the RING finger domain sometimes enhances antiapoptotic activity but does not inhibit apoptosis alone. Two transcript variants encoding different isoforms have been found for this gene. The two isoforms have different antiapoptotic properties, with isoform alpha protecting cells from apoptosis induced by staurosporine and isoform b protecting cells from apoptosis induced by etoposide.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 35.64 kDa
AA Sequence : MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELR
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BIRC7 baculoviral IAP repeat containing 7 [ Homo sapiens ]
Official Symbol BIRC7
Synonyms BIRC7; baculoviral IAP repeat containing 7; baculoviral IAP repeat-containing protein 7; KIAP; kidney inhibitor of apoptosis protein; livin; livin inhibitor of apoptosis; melanoma inhibitor of apoptosis protein; ML IAP; mliap; RNF50; RING finger protein 50; LIVIN; MLIAP; ML-IAP;
Gene ID 79444
mRNA Refseq NM_022161
Protein Refseq NP_071444
MIM 605737
UniProt ID Q96CA5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BIRC7 Products

Required fields are marked with *

My Review for All BIRC7 Products

Required fields are marked with *

0
cart-icon
0
compare icon