Recombinant Human BIRC7 protein, GST-tagged
| Cat.No. : | BIRC7-301202H |
| Product Overview : | Recombinant Human BIRC7 (151-240 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Cys151-Glu240 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | CQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAQAQRAWWVLEPPGARDVE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | BIRC7 baculoviral IAP repeat containing 7 [ Homo sapiens ] |
| Official Symbol | BIRC7 |
| Synonyms | BIRC7; baculoviral IAP repeat containing 7; baculoviral IAP repeat-containing protein 7; KIAP; kidney inhibitor of apoptosis protein; livin; livin inhibitor of apoptosis; melanoma inhibitor of apoptosis protein; ML IAP; mliap; RNF50; RING finger protein 50; LIVIN; MLIAP; ML-IAP; |
| Gene ID | 79444 |
| mRNA Refseq | NM_022161 |
| Protein Refseq | NP_071444 |
| MIM | 605737 |
| UniProt ID | Q96CA5 |
| ◆ Recombinant Proteins | ||
| BIRC7-3679H | Recombinant Human BIRC7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| BIRC7-432H | Active Recombinant Human BIRC7, His-tagged | +Inquiry |
| Birc7-1870M | Recombinant Mouse Birc7 Protein, Myc/DDK-tagged | +Inquiry |
| BIRC7-1036M | Recombinant Mouse BIRC7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BIRC7-0092H | Recombinant Human BIRC7 Protein (M1-S298), Tag Free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BIRC7-8447HCL | Recombinant Human BIRC7 293 Cell Lysate | +Inquiry |
| BIRC7-8448HCL | Recombinant Human BIRC7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BIRC7 Products
Required fields are marked with *
My Review for All BIRC7 Products
Required fields are marked with *
