"BIRC8" Related Products

Recombinant Human BIRC8 Protein, GST-tagged

Cat.No. : BIRC8-234H
Product Overview : Human BIRC8 partial ORF ( NP_203127, 127 a.a. - 236 a.a.) recombinant protein with GST-tag at N-terminal.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.84 kDa
AA Sequence : DVKKIMEERIQTSGSNYKTLEVLVADLVSAQKDTTENELNQTSLQREISPEEPLRRLQEEKLCKICMDRHIAVVFIPCGHLVTCKQCAEAVDRCPMCSAVIDFKQRVFMS
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : BIRC8 baculoviral IAP repeat containing 8 [ Homo sapiens ]
Official Symbol : BIRC8
Synonyms : BIRC8; baculoviral IAP repeat containing 8; baculoviral IAP repeat-containing protein 8; hILP2; IAP like protein 2; ILP 2; inhibitor of apoptosis like protein 2; IAP-like protein 2; baculoviral IAP repeat-containing 8; inhibitor of apoptosis-like protein
Gene ID : 112401
mRNA Refseq : NM_033341
Protein Refseq : NP_203127
UniProt ID : Q96P09

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.