Recombinant Human BIRC8 Protein, GST-tagged
Cat.No. : | BIRC8-234H |
Product Overview : | Human BIRC8 partial ORF ( NP_203127, 127 a.a. - 236 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | DVKKIMEERIQTSGSNYKTLEVLVADLVSAQKDTTENELNQTSLQREISPEEPLRRLQEEKLCKICMDRHIAVVFIPCGHLVTCKQCAEAVDRCPMCSAVIDFKQRVFMS |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BIRC8 baculoviral IAP repeat containing 8 [ Homo sapiens ] |
Official Symbol | BIRC8 |
Synonyms | BIRC8; baculoviral IAP repeat containing 8; baculoviral IAP repeat-containing protein 8; hILP2; IAP like protein 2; ILP 2; inhibitor of apoptosis like protein 2; IAP-like protein 2; baculoviral IAP repeat-containing 8; inhibitor of apoptosis-like protein |
Gene ID | 112401 |
mRNA Refseq | NM_033341 |
Protein Refseq | NP_203127 |
UniProt ID | Q96P09 |
◆ Recombinant Proteins | ||
BIRC8-1641HF | Recombinant Full Length Human BIRC8 Protein, GST-tagged | +Inquiry |
BIRC8-10235H | Recombinant Human BIRC8, GST-tagged | +Inquiry |
BIRC8-234H | Recombinant Human BIRC8 Protein, GST-tagged | +Inquiry |
BIRC8-233H | Recombinant Human BIRC8 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BIRC8-171HCL | Recombinant Human BIRC8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BIRC8 Products
Required fields are marked with *
My Review for All BIRC8 Products
Required fields are marked with *