Recombinant Human BLOC1S2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: BLOC1S2-5521H
• Product Overview: BLOC1S2 MS Standard C13 and N15-labeled recombinant protein (NP_001001342) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a protein with multiple functions. The encoded protein has been found in association with the centrosome, shown to co-localize with gamma-tubulin, and also found to be one of the proteins in the BLOC-1 complex which functions in the formation of lysosome-related organelles. A pseudogene of this gene is located on the X chromosome. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 11.5 kDa
• AA Sequence: MFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: BLOC1S2 biogenesis of lysosomal organelles complex 1 subunit 2 [ Homo sapiens (human) ]
• Official Symbol: BLOC1S2
• Synonyms: BLOC1S2; biogenesis of lysosomal organelles complex-1, subunit 2; biogenesis of lysosome-related organelles complex 1 subunit 2; Biogenesis of Lysosome related Organelles complex 1 Subunit 2; BLOS2; centrosome protein oncogene; FLJ30135; MGC10120; BLOC-1 subunit 2; centrosomal 10 kDa protein; centrosome-associated protein; RP11-316M21.4
• Gene ID: 282991
• mRNA Refseq: NM_001001342
• Protein Refseq: NP_001001342
• MIM: 609768
• UniProt ID: Q6QNY1