Recombinant Human BLOC1S2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : BLOC1S2-5521H
Product Overview : BLOC1S2 MS Standard C13 and N15-labeled recombinant protein (NP_001001342) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein with multiple functions. The encoded protein has been found in association with the centrosome, shown to co-localize with gamma-tubulin, and also found to be one of the proteins in the BLOC-1 complex which functions in the formation of lysosome-related organelles. A pseudogene of this gene is located on the X chromosome. Alternative splicing results in multiple transcript variants.
Molecular Mass : 11.5 kDa
AA Sequence : MFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name BLOC1S2 biogenesis of lysosomal organelles complex 1 subunit 2 [ Homo sapiens (human) ]
Official Symbol BLOC1S2
Synonyms BLOC1S2; biogenesis of lysosomal organelles complex-1, subunit 2; biogenesis of lysosome-related organelles complex 1 subunit 2; Biogenesis of Lysosome related Organelles complex 1 Subunit 2; BLOS2; centrosome protein oncogene; FLJ30135; MGC10120; BLOC-1 subunit 2; centrosomal 10 kDa protein; centrosome-associated protein; RP11-316M21.4;
Gene ID 282991
mRNA Refseq NM_001001342
Protein Refseq NP_001001342
MIM 609768
UniProt ID Q6QNY1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BLOC1S2 Products

Required fields are marked with *

My Review for All BLOC1S2 Products

Required fields are marked with *

0
cart-icon
0
compare icon