Recombinant Human BLOC1S2 protein, GST-tagged

• Cat.No.: BLOC1S2-7382H
• Product Overview: Recombinant Human BLOC1S2 protein(1-99 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-99 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: MFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: BLOC1S2 biogenesis of lysosomal organelles complex-1, subunit 2 [ Homo sapiens ]
• Official Symbol: BLOC1S2
• Synonyms: BLOC1S2; biogenesis of lysosomal organelles complex-1, subunit 2; biogenesis of lysosome-related organelles complex 1 subunit 2; Biogenesis of Lysosome related Organelles complex 1 Subunit 2; BLOS2; centrosome protein oncogene; FLJ30135; MGC10120; BLOC-1 subunit 2; centrosomal 10 kDa protein; centrosome-associated protein; RP11-316M21.4
• Gene ID: 282991
• mRNA Refseq: NM_173809
• Protein Refseq: NP_776170
• MIM: 609768
• UniProt ID: Q6QNY1