Recombinant Human BLOC1S2 protein, GST-tagged
Cat.No. : | BLOC1S2-7382H |
Product Overview : | Recombinant Human BLOC1S2 protein(1-99 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-99 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | BLOC1S2 biogenesis of lysosomal organelles complex-1, subunit 2 [ Homo sapiens ] |
Official Symbol | BLOC1S2 |
Synonyms | BLOC1S2; biogenesis of lysosomal organelles complex-1, subunit 2; biogenesis of lysosome-related organelles complex 1 subunit 2; Biogenesis of Lysosome related Organelles complex 1 Subunit 2; BLOS2; centrosome protein oncogene; FLJ30135; MGC10120; BLOC-1 subunit 2; centrosomal 10 kDa protein; centrosome-associated protein; RP11-316M21.4; |
Gene ID | 282991 |
mRNA Refseq | NM_173809 |
Protein Refseq | NP_776170 |
MIM | 609768 |
UniProt ID | Q6QNY1 |
◆ Recombinant Proteins | ||
Bloc1s2-1873M | Recombinant Mouse Bloc1s2 Protein, Myc/DDK-tagged | +Inquiry |
BLOC1S2-4770C | Recombinant Chicken BLOC1S2 | +Inquiry |
BLOC1S2-7382H | Recombinant Human BLOC1S2 protein, GST-tagged | +Inquiry |
BLOC1S2-990R | Recombinant Rat BLOC1S2 Protein | +Inquiry |
BLOC1S2-10241H | Recombinant Human BLOC1S2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BLOC1S2-8443HCL | Recombinant Human BLOC1S2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BLOC1S2 Products
Required fields are marked with *
My Review for All BLOC1S2 Products
Required fields are marked with *