Recombinant Human BLVRB Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | BLVRB-1389H |
| Product Overview : | BLVRB MS Standard C13 and N15-labeled recombinant protein (NP_000704) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The final step in heme metabolism in mammals is catalyzed by the cytosolic biliverdin reductase enzymes A and B (EC 1.3.1.24). |
| Molecular Mass : | 22.1 kDa |
| AA Sequence : | MAVKKIAIFGATGQTGLTTLAQAVQAGYEVTVLVRDSSRLPSEGPRPAHVVVGDVLQAADVDKTVAGQDAVIVLLGTRNDLSPTTVMSEGARNIVAAMKAHGVDKVVACTSAFLLWDPTKVPPRLQAVTDDHIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | BLVRB biliverdin reductase B [ Homo sapiens (human) ] |
| Official Symbol | BLVRB |
| Synonyms | BLVRB; biliverdin reductase B (flavin reductase (NADPH)); Flavin reductase, FLR; flavin reductase (NADPH); SDR43U1; short chain dehydrogenase/reductase family 43U; member 1; FR; GHBP; BVR-B; NADPH-flavin reductase; NADPH-dependent diaphorase; green heme-binding protein; biliverdin-IX beta-reductase; short chain dehydrogenase/reductase family 43U, member 1; FLR; BVRB; MGC117413; |
| Gene ID | 645 |
| mRNA Refseq | NM_000713 |
| Protein Refseq | NP_000704 |
| MIM | 600941 |
| UniProt ID | P30043 |
| ◆ Recombinant Proteins | ||
| BLVRB-08H | Active Recombinant Full Length Human BLVRB Protein, His Tagged | +Inquiry |
| BLVRB-10243H | Recombinant Human BLVRB, GST-tagged | +Inquiry |
| BLVRB-9654H | Recombinant Human BLVRB protein, His-tagged | +Inquiry |
| BLVRB-250H | Recombinant Human BLVRB Protein, GST-tagged | +Inquiry |
| BLVRB-26281TH | Recombinant Human BLVRB | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BLVRB-8440HCL | Recombinant Human BLVRB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BLVRB Products
Required fields are marked with *
My Review for All BLVRB Products
Required fields are marked with *



