Recombinant Human BLZF1 Protein, GST-tagged

• Cat.No.: BLZF1-253H
• Product Overview: Human BLZF1 partial ORF ( NP_003657, 301 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: KLAKAVNSHLLGNVGINNQKKIPSTVEFCSTPAEKMAETVLRILDPVTCKESSPDNPFFESSPTTLLATKKNIGRFHPYTRYENITFNCCNHCRGELIAL
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BLZF1 basic leucine zipper nuclear factor 1 [ Homo sapiens ]
• Official Symbol: BLZF1
• Synonyms: BLZF1; basic leucine zipper nuclear factor 1; Golgin-45; JEM 1; JEM-1short protein; cytoplasmic protein; p45 basic leucine-zipper nuclear factor; JEM1; JEM-1; JEM-1s; GOLGIN-45; MGC22497
• Gene ID: 8548
• mRNA Refseq: NM_003666
• Protein Refseq: NP_003657
• MIM: 608692
• UniProt ID: Q9H2G9