Recombinant Human BLZF1 Protein, GST-tagged
Cat.No. : | BLZF1-253H |
Product Overview : | Human BLZF1 partial ORF ( NP_003657, 301 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | KLAKAVNSHLLGNVGINNQKKIPSTVEFCSTPAEKMAETVLRILDPVTCKESSPDNPFFESSPTTLLATKKNIGRFHPYTRYENITFNCCNHCRGELIAL |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BLZF1 basic leucine zipper nuclear factor 1 [ Homo sapiens ] |
Official Symbol | BLZF1 |
Synonyms | BLZF1; basic leucine zipper nuclear factor 1; Golgin-45; JEM 1; JEM-1short protein; cytoplasmic protein; p45 basic leucine-zipper nuclear factor; JEM1; JEM-1; JEM-1s; GOLGIN-45; MGC22497; |
Gene ID | 8548 |
mRNA Refseq | NM_003666 |
Protein Refseq | NP_003657 |
MIM | 608692 |
UniProt ID | Q9H2G9 |
◆ Recombinant Proteins | ||
BLZF1-253H | Recombinant Human BLZF1 Protein, GST-tagged | +Inquiry |
BLZF1-10244H | Recombinant Human BLZF1, His-tagged | +Inquiry |
BLZF1-1719HF | Recombinant Full Length Human BLZF1 Protein, GST-tagged | +Inquiry |
BLZF1-252H | Recombinant Human BLZF1 Protein, GST-tagged | +Inquiry |
BLZF1-7291Z | Recombinant Zebrafish BLZF1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
BLZF1-8439HCL | Recombinant Human BLZF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BLZF1 Products
Required fields are marked with *
My Review for All BLZF1 Products
Required fields are marked with *