Recombinant Human BMI1 Protein(1-117aa), GST-tagged
Cat.No. : | GABARAPL2-482H |
Product Overview : | Recombinant Human BMI1 Protein(1-117aa)(P60520), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-117aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.7kDa |
AA Sequence : | MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | GABARAPL2 GABA(A) receptor-associated protein-like 2 [ Homo sapiens ] |
Official Symbol | GABARAPL2 |
Synonyms | GABARAPL2; GABA(A) receptor-associated protein-like 2; gamma-aminobutyric acid receptor-associated protein-like 2; ATG8; ATG8C; GATE 16; GATE16; GEF2; ganglioside expression factor 2; MAP1 light chain 3 related protein; MAP1 light chain 3-related protein; general protein transport factor p16; golgi-associated ATPase enhancer of 16 kDa; GEF-2; GATE-16; |
Gene ID | 11345 |
mRNA Refseq | NM_007285 |
Protein Refseq | NP_009216 |
MIM | 607452 |
UniProt ID | P60520 |
◆ Recombinant Proteins | ||
GABARAPL2-2239H | Recombinant Human GABARAPL2 protein, His-tagged | +Inquiry |
GABARAPL2-11743Z | Recombinant Zebrafish GABARAPL2 | +Inquiry |
GABARAPL2-844H | Recombinant Human GABARAPL2 | +Inquiry |
GABARAPL2-482H | Recombinant Human BMI1 Protein(1-117aa), GST-tagged | +Inquiry |
GABARAPL2-27460TH | Recombinant Human GABARAPL2, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GABARAPL2 Products
Required fields are marked with *
My Review for All GABARAPL2 Products
Required fields are marked with *
0
Inquiry Basket