Recombinant Human GABARAPL2, His-tagged

Cat.No. : GABARAPL2-27460TH
Product Overview : Recombinant full length Human GABARAPL2 with an N terminal His tag; 137 amino acids with a predicted MWt 15.8 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 117 amino acids
Description : GABARAPL2, also known as ATG8, is involved in intra Golgi traffic and modulates intra Golgi transport through coupling between NSF activity and SNAREs activation.
Conjugation : HIS
Molecular Weight : 15.800kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
Gene Name GABARAPL2 GABA(A) receptor-associated protein-like 2 [ Homo sapiens ]
Official Symbol GABARAPL2
Synonyms GABARAPL2; GABA(A) receptor-associated protein-like 2; gamma-aminobutyric acid receptor-associated protein-like 2; ATG8; ATG8C; GATE 16; GATE16; GEF2;
Gene ID 11345
mRNA Refseq NM_007285
Protein Refseq NP_009216
MIM 607452
Uniprot ID P60520
Chromosome Location 16q22.1
Pathway GABAergic synapse, organism-specific biosystem; GABAergic synapse, conserved biosystem; Regulation of autophagy, organism-specific biosystem; Regulation of autophagy, conserved biosystem; Senescence and Autophagy, organism-specific biosystem;
Function ATPase binding; GABA receptor binding; GABA receptor binding; SNARE binding; beta-tubulin binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GABARAPL2 Products

Required fields are marked with *

My Review for All GABARAPL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon