Recombinant Human GABARAPL2, His-tagged
Cat.No. : | GABARAPL2-27460TH |
Product Overview : | Recombinant full length Human GABARAPL2 with an N terminal His tag; 137 amino acids with a predicted MWt 15.8 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 117 amino acids |
Description : | GABARAPL2, also known as ATG8, is involved in intra Golgi traffic and modulates intra Golgi transport through coupling between NSF activity and SNAREs activation. |
Conjugation : | HIS |
Molecular Weight : | 15.800kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF |
Gene Name | GABARAPL2 GABA(A) receptor-associated protein-like 2 [ Homo sapiens ] |
Official Symbol | GABARAPL2 |
Synonyms | GABARAPL2; GABA(A) receptor-associated protein-like 2; gamma-aminobutyric acid receptor-associated protein-like 2; ATG8; ATG8C; GATE 16; GATE16; GEF2; |
Gene ID | 11345 |
mRNA Refseq | NM_007285 |
Protein Refseq | NP_009216 |
MIM | 607452 |
Uniprot ID | P60520 |
Chromosome Location | 16q22.1 |
Pathway | GABAergic synapse, organism-specific biosystem; GABAergic synapse, conserved biosystem; Regulation of autophagy, organism-specific biosystem; Regulation of autophagy, conserved biosystem; Senescence and Autophagy, organism-specific biosystem; |
Function | ATPase binding; GABA receptor binding; GABA receptor binding; SNARE binding; beta-tubulin binding; |
◆ Recombinant Proteins | ||
GABARAPL2-27460TH | Recombinant Human GABARAPL2, His-tagged | +Inquiry |
GABARAPL2-9632H | Recombinant Human GABARAPL2 protein, His-tagged | +Inquiry |
GABARAPL2-5149HF | Recombinant Full Length Human GABARAPL2 Protein, GST-tagged | +Inquiry |
GABARAPL2-2442R | Recombinant Rat GABARAPL2 Protein | +Inquiry |
GABARAPL2-2991H | Recombinant Human GABARAPL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GABARAPL2 Products
Required fields are marked with *
My Review for All GABARAPL2 Products
Required fields are marked with *
0
Inquiry Basket